1. Recombinant Proteins
  2. Others
  3. SOX17 Protein, Human

SOX17 Protein, Human is the recombinant human-derived SOX17, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOX17 Protein, Human is the recombinant human-derived SOX17, expressed by E. coli , with tag Free labeled tag. ,

Background

SOX17 is a transcription regulator that binds target promoter DNA and bends the DNA, recognizing sequences 5'-AACAAT-3' or 5'-AACAAAG-3'. It modulates transcriptional regulation via WNT3A, inhibits Wnt signaling, and promotes degradation of activated CTNNB1. SOX17 plays a key role in embryonic development, including the formation of definitive gut endoderm and proper looping of the embryonic heart tube. It is also essential for embryonic and postnatal vascular development, such as artery formation, and exhibits functional redundancy with SOX18 in postnatal angiogenesis. Additionally, SOX17 is required for the generation and maintenance of fetal hematopoietic stem cells and fetal hematopoiesis. It may act as a transcriptional activator in premeiotic germ cells.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9H6I2 (S66-Q144)

Gene ID

64321

Protein Length

Partial

Synonyms
Transcription factor SOX-17; SOX17; Homo sapiens; Human; Activator; DNA-binding
AA Sequence

SRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQ

Predicted Molecular Mass
9.8 kDa
Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SOX17 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SOX17 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOX17 Protein, Human
Cat. No.:
HY-P703358
Quantity:
MCE Japan Authorized Agent: