SOX17 Protein, Human
Based on 1 Customer Validation
SOX17 Protein, Human is the recombinant human-derived SOX17, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SOX17 Protein, Human is the recombinant human-derived SOX17, expressed by E. coli , with tag Free labeled tag. ,
SOX17 is a transcription regulator that binds target promoter DNA and bends the DNA, recognizing sequences 5'-AACAAT-3' or 5'-AACAAAG-3'. It modulates transcriptional regulation via WNT3A, inhibits Wnt signaling, and promotes degradation of activated CTNNB1. SOX17 plays a key role in embryonic development, including the formation of definitive gut endoderm and proper looping of the embryonic heart tube. It is also essential for embryonic and postnatal vascular development, such as artery formation, and exhibits functional redundancy with SOX18 in postnatal angiogenesis. Additionally, SOX17 is required for the generation and maintenance of fetal hematopoietic stem cells and fetal hematopoiesis. It may act as a transcriptional activator in premeiotic germ cells.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9H6I2 (S66-Q144)
-
Gene ID64321
-
Protein Length
Partial
-
Synonyms
SOX17; SRY-Related HMG-Box Transcription Factor SOX17; SRY-Box Transcription Factor 17; SOX17 Protein; SRY (Sex Determining Region Y)-Box 17; PPH7; Transcription Factor SOX-17; VUR3; SRY-Box 17
-
AA Sequence
SRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQ
-
Predicted Molecular Mass
9.8 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
