1. Recombinant Proteins
  2. Others
  3. Sox2 Protein, Human

Sox2 protein is a key transcription factor that forms a trimeric complex with OCT4 and controls the expression of genes critical for embryonic development (YES1, FGF4, UTF1, ZFP206). It binds the NANOG enhancer and is critical for early embryogenesis and stem cell pluripotency. Sox2 Protein, Human is the recombinant human-derived Sox2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Sox2 protein is a key transcription factor that forms a trimeric complex with OCT4 and controls the expression of genes critical for embryonic development (YES1, FGF4, UTF1, ZFP206). It binds the NANOG enhancer and is critical for early embryogenesis and stem cell pluripotency. Sox2 Protein, Human is the recombinant human-derived Sox2 protein, expressed by E. coli , with tag free.

Background

Sox2, a pivotal transcription factor, forms a trimeric complex with OCT4 on DNA, exerting control over the expression of genes crucial in embryonic development, such as YES1, FGF4, UTF1, and ZFP206. It binds to the proximal enhancer region of NANOG, playing a critical role in early embryogenesis and maintaining embryonic stem cell pluripotency. Functioning as a downstream target of SRRT, Sox2 contributes to the promotion of neural stem cell self-renewal while preventing neural cell differentiation through counteraction against proneural proteins. Additionally, it may serve as a switch in neuronal development. Sox2 engages in various interactions, including those with ZSCAN10, SOX3, FGFR1, GLIS1, POU5F1, DDX56, L3MBTL3, DCAF5, RCOR1/CoREST, PHF20L1, and TRIM26, underscoring its dynamic regulatory network. These interactions highlight its involvement in critical cellular processes, including ubiquitination, degradation protection, and prevention of ubiquitination by specific ligases.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P48431 (R40-D123)

Gene ID

6657

Molecular Construction
N-term
Sox2 (R40-D123)
Accession # P48431
C-term
Protein Length

Partial

Synonyms
SOX2; Transcription factor SOX-2
AA Sequence

RVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKD

Predicted Molecular Mass
10.4 KDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, pH7.5, 150 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Sox2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Sox2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sox2 Protein, Human
Cat. No.:
HY-P701993
Quantity:
MCE Japan Authorized Agent: