Sox2 Protein, Human
Based on 1 Customer Validation
Sox2 protein is a key transcription factor that forms a trimeric complex with OCT4 and controls the expression of genes critical for embryonic development (YES1, FGF4, UTF1, ZFP206). It binds the NANOG enhancer and is critical for early embryogenesis and stem cell pluripotency. Sox2 Protein, Human is the recombinant human-derived Sox2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Sox2 protein is a key transcription factor that forms a trimeric complex with OCT4 and controls the expression of genes critical for embryonic development (YES1, FGF4, UTF1, ZFP206). It binds the NANOG enhancer and is critical for early embryogenesis and stem cell pluripotency. Sox2 Protein, Human is the recombinant human-derived Sox2 protein, expressed by E. coli , with tag free.
Background
Sox2, a pivotal transcription factor, forms a trimeric complex with OCT4 on DNA, exerting control over the expression of genes crucial in embryonic development, such as YES1, FGF4, UTF1, and ZFP206. It binds to the proximal enhancer region of NANOG, playing a critical role in early embryogenesis and maintaining embryonic stem cell pluripotency. Functioning as a downstream target of SRRT, Sox2 contributes to the promotion of neural stem cell self-renewal while preventing neural cell differentiation through counteraction against proneural proteins. Additionally, it may serve as a switch in neuronal development. Sox2 engages in various interactions, including those with ZSCAN10, SOX3, FGFR1, GLIS1, POU5F1, DDX56, L3MBTL3, DCAF5, RCOR1/CoREST, PHF20L1, and TRIM26, underscoring its dynamic regulatory network. These interactions highlight its involvement in critical cellular processes, including ubiquitination, degradation protection, and prevention of ubiquitination by specific ligases.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P48431 (R40-D123)
-
Gene ID6657
-
Molecular Construction
-
N-term
-
Sox2 (R40-D123)
Accession # P48431 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SOX2; SRY-Box 2; SRY-Box Transcription Factor 2; SRY-Related HMG-Box Gene 2; SRY (Sex Determining Region Y)-Box 2; Transcription Factor SOX2; Transcription Factor SOX-2; MCOPS3; Sex Determining Region Y-Box 2; ANOP3
-
AA Sequence
RVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKD
-
Predicted Molecular Mass
10.4 KDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris, pH7.5, 150 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)