SP-D Protein, Human (HEK293, His)
Based on 1 Customer Validation
The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The SP-D protein plays a crucial role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. It engages with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby influencing leukocyte activity in the immune response. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of respiratory function. The protein exhibits a strong binding affinity for maltose residues and, to a lesser extent, other alpha-glucosyl moieties. Notably, SP-D forms an oligomeric complex comprising four sets of homotrimers, emphasizing its structural organization in facilitating its diverse functions (
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH22318.1 (A21-F375)
-
Molecular Construction
-
N-term
-
SP-D (A21-F375)
Accession # AAH22318.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Pulmonary surfactant-associated protein D Chain
-
Synonyms
SFTPD; Collectin-7; Prev. SFTP4; Surfactant, Pulmonary-Associated Protein D; COLEC7; Surfactant-Associated Protein, Pulmonary 4; SP-D; Pulmonary Surfactant Apoprotein; Pulmonary Surfactant-Associated Protein D; PSPD; Lung Surfactant Protein D; Surfactant
-
AA Sequence
AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
-
Predicted Molecular Mass
36.5 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
