1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. speA Protein, Shewanella putrefaciens (FLAG, His)

speA Protein, Shewanella putrefaciens (FLAG, His)

Cat. No.: HY-P702091
Handling Instructions Technical Support

The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens (FLAG, His) is the recombinant speA protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens (FLAG, His) is the recombinant speA protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Background

The speA protein serves as a catalytic linchpin in the intricate biosynthetic journey from arginine to agmatine. With precision and enzymatic finesse, speA orchestrates the conversion, showcasing its pivotal role in this biochemical pathway. The transformation guided by speA underscores its indispensability in cellular metabolism, accentuating the protein's significance in sustaining the delicate equilibrium of essential biological processes within the cell. In catalyzing the synthesis of agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions.

Species

Others

Source

E. coli

Tag

N-6*His;N-Flag

Accession

A4Y5Y9 (M1-S637)

Gene ID

/

Molecular Construction
N-term
Flag-6*His
speA (M1-S637)
Accession # A4Y5Y9
C-term
Protein Length

Full Length

Synonyms
speA; Biosynthetic arginine decarboxylase; ADC
AA Sequence

MNDWSIDDARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPEYKIGLNELAKDMVKAGVALPVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQNDMLDSLQLLHFHLGSQIANIRDIRQGVSEAGRFYCELRELGASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEYAQPMPRIISESGRYLTAHHAVLITDVIGTEAYQPENIQPPAEESPQLLHNMWHSWSEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGIDQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLIGFFLVGAYQEILGDMHNLFGDTNSAVVRIEENGVTNIESVLAGDTVADVLRYVNLDAVAFMRTYEELVNLHIEEDERAQILEELQVGLKGYTYLEDFS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

speA Protein, Shewanella putrefaciens (FLAG, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

speA Protein, Shewanella putrefaciens (FLAG, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
speA Protein, Shewanella putrefaciens (FLAG, His)
Cat. No.:
HY-P702091
Quantity:
MCE Japan Authorized Agent: