speA Protein, Shewanella putrefaciens (FLAG, His)

The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens (FLAG, His) is the recombinant speA protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens (FLAG, His) is the recombinant speA protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Background

The speA protein serves as a catalytic linchpin in the intricate biosynthetic journey from arginine to agmatine. With precision and enzymatic finesse, speA orchestrates the conversion, showcasing its pivotal role in this biochemical pathway. The transformation guided by speA underscores its indispensability in cellular metabolism, accentuating the protein's significance in sustaining the delicate equilibrium of essential biological processes within the cell. In catalyzing the synthesis of agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-6*His;N-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Flag-6*His
    • speA (M1-S637)
      Accession # A4Y5Y9
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Biosynthetic arginine decarboxylase; EC:4.1.1.19; ADC ; speA; Sputcn32_1647

  • AA Sequence

    MNDWSIDDARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPEYKIGLNELAKDMVKAGVALPVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQNDMLDSLQLLHFHLGSQIANIRDIRQGVSEAGRFYCELRELGASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEYAQPMPRIISESGRYLTAHHAVLITDVIGTEAYQPENIQPPAEESPQLLHNMWHSWSEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGIDQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLIGFFLVGAYQEILGDMHNLFGDTNSAVVRIEENGVTNIESVLAGDTVADVLRYVNLDAVAFMRTYEELVNLHIEEDERAQILEELQVGLKGYTYLEDFS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00