speA Protein, Shewanella putrefaciens
The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens is the recombinant speA protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The speA protein plays a crucial role in catalyzing the transformation from arginine to agmatine. This enzymatic conversion highlights speA's significance in sustaining cellular metabolism and essential biological processes. By synthesizing agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions. speA Protein, Shewanella putrefaciens is the recombinant speA protein, expressed by E. coli , with tag free.
Background
The speA protein serves as a catalytic linchpin in the intricate biosynthetic journey from arginine to agmatine. With precision and enzymatic finesse, speA orchestrates the conversion, showcasing its pivotal role in this biochemical pathway. The transformation guided by speA underscores its indispensability in cellular metabolism, accentuating the protein's significance in sustaining the delicate equilibrium of essential biological processes within the cell. In catalyzing the synthesis of agmatine, speA emerges as a key player in the intricate dance of molecular transformations that characterize fundamental cellular functions.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
A4Y5Y9 (M1-S637)
-
Gene ID/
-
Molecular Construction
-
N-term
-
speA (M1-S637)
Accession # A4Y5Y9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Biosynthetic arginine decarboxylase; EC:4.1.1.19; ADC ; speA; Sputcn32_1647
-
AA Sequence
MNDWSIDDARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPEYKIGLNELAKDMVKAGVALPVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQQTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVTPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQNDMLDSLQLLHFHLGSQIANIRDIRQGVSEAGRFYCELRELGASVNCFDVGGGLAVDYDGTRSQSNNSMNYGLTEYANNIVNVLTDICNEYAQPMPRIISESGRYLTAHHAVLITDVIGTEAYQPENIQPPAEESPQLLHNMWHSWSEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGIDQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLIGFFLVGAYQEILGDMHNLFGDTNSAVVRIEENGVTNIESVLAGDTVADVLRYVNLDAVAFMRTYEELVNLHIEEDERAQILEELQVGLKGYTYLEDFS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)