SPINK1 Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
SPINK1 is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. In the male reproductive tract, SPINK1 binds to sperm heads and regulates sperm volume by inhibiting calcium absorption and nitrogen oxide (NO) production. SPINK1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived SPINK1 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SPINK1 is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. In the male reproductive tract, SPINK1 binds to sperm heads and regulates sperm volume by inhibiting calcium absorption and nitrogen oxide (NO) production. SPINK1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived SPINK1 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
SPINK1, a serine protease inhibitor, functions as an anti-trypsin agent, exhibiting inhibitory activity against trypsin. Particularly crucial in the pancreas, SPINK1 serves as a protective factor preventing the premature activation of zymogens catalyzed by trypsin. Beyond its pancreatic role, SPINK1 plays a distinctive function in the male reproductive tract, where it binds to sperm heads. In this context, it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. These diverse roles highlight the significance of SPINK1 in regulating proteolytic activity and contributing to the protective mechanisms in both the pancreas and male reproductive processes.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P09036 (A24-C80)
-
Gene ID20730
-
Molecular Construction
-
N-term
-
6*His
-
SPINK1 (A24-C80)
Accession # P09036 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPINK1; PCTT; Serine Peptidase Inhibitor Kazal Type 1; Serine Protease Inhibitor, Kazal Type 1; PSTI; Serine Protease Inhibitor Kazal-Type 1; TATI; Tumor-Associated Trypsin Inhibitor; Pancreatic Secretory Trypsin Inhibitor; TCP; Spink3
-
AA Sequence
AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
-
Predicted Molecular Mass
8.1 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
