1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. SPINK1 Protein, Mouse (P.pastoris, His)

SPINK1 is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. In the male reproductive tract, SPINK1 binds to sperm heads and regulates sperm volume by inhibiting calcium absorption and nitrogen oxide (NO) production. SPINK1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived SPINK1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPINK1 is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. In the male reproductive tract, SPINK1 binds to sperm heads and regulates sperm volume by inhibiting calcium absorption and nitrogen oxide (NO) production. SPINK1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived SPINK1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

SPINK1, a serine protease inhibitor, functions as an anti-trypsin agent, exhibiting inhibitory activity against trypsin. Particularly crucial in the pancreas, SPINK1 serves as a protective factor preventing the premature activation of zymogens catalyzed by trypsin. Beyond its pancreatic role, SPINK1 plays a distinctive function in the male reproductive tract, where it binds to sperm heads. In this context, it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. These diverse roles highlight the significance of SPINK1 in regulating proteolytic activity and contributing to the protective mechanisms in both the pancreas and male reproductive processes.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P09036 (A24-C80)

Gene ID

20730

Molecular Construction
N-term
6*His
SPINK1 (A24-C80)
Accession # P09036
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Pancreatic Secretory Trypsin Inhibitor; Serine Protease Inhibitor Kazal-Type 1; Tumor-Associated Trypsin Inhibitor; TATI; SPINK1; PSTI
AA Sequence

AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC

Predicted Molecular Mass
8.1 kDa
Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPINK1 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPINK1 Protein, Mouse (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPINK1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P702493
Quantity:
MCE Japan Authorized Agent: