SRPX2 Protein, Mouse (Myc, His-SUMO)

Customer Review

Based on 1 Customer Validation

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

SRPX2 Protein serves as a ligand for the urokinase plasminogen activator surface receptor, contributing to angiogenesis by inducing endothelial cell migration and the formation of vascular networks. Additionally, it plays a crucial role in cellular migration and adhesion, elevates phosphorylation levels of FAK (focal adhesion kinase), and interacts with and enhances the mitogenic activity of HGF (hepatocyte growth factor). SRPX2 also participates in synapse formation and is essential for ultrasonic vocalizations. It forms homooligomers and interacts with PLAUR, ADAMTS4, and CTSB, further emphasizing its multifaceted roles in cellular processes and signaling pathways.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His;C-Myc;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • SRPX2 (W26-E468)
      Accession # Q8R054
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SRPX2; Sushi-Repeat-Containing Protein, X-Linked 2; Sushi Repeat Containing Protein X-Linked 2; RESDX; SRPUL; CBPS; Sushi Repeat-Containing Protein SRPX2; PMGX; Sushi-Repeat Protein Upregulated In Leukemia; BPP; Sushi-Repeat Protein Up-Regulated In Leukem

  • AA Sequence

    WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

  • Predicted Molecular Mass

    66.6 kDa

  • Molecular Weight

    Approximately 66-70 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00