srtA Protein, S. aureus (His)

srtA Protein, S. aureus (His) is the recombinant srtA protein, expressed by E. coli, with C-6*His tag.

srtA is a transpeptidase that anchors surface proteins to the cell wall. It recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal, forming a covalent intermediate via a thioester bond between the sortase and its substrate, which is then transferred and attached to the cell wall. This enzyme cleaves the Leu-Pro-x-Thr-Gly (LPXTG) motif between the threonine and glycine residues and utilizes lipid II as the peptidoglycan substrate for the sorting reaction. It is responsible for displaying virulence factors and plays a key role in host interactions and colonization during infection. by similar: This function is consistently reported across multiple studies.

Others

E. coli

C-6*His

Q2FV99 (Q60-K206, P94S, D160N, D165A, G167E, K196T)

3921273

Partial

QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATSEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQKGKDKQLTLITCDDYNEKTGVWETRKIFVATEVK

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris HCl, pH 7.5, 150 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.