SRXN1 Protein, Human (His, Myc)
SRXN1 Protein, Human (His, Myc) is the recombinant human-derived SRXN1 protein, expressed by E. coli, with N-10*His & C-Myc tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SRXN1 Protein, Human (His, Myc) is the recombinant human-derived SRXN1 protein, expressed by E. coli, with N-10*His & C-Myc tag.
Background
SRXN1 contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed in peroxiredoxins PRDX1, PRDX2, PRDX3, and PRDX4 under oxidant exposure. It does not act on PRDX5 or PRDX6. The protein may catalyze the reduction in a multi-step process by functioning as both a specific phosphotransferase and a thioltransferase. by similar: This function is associated with SRXN1's protective role in oxidative stress.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q9BYN0 (M1-S120)
-
Gene ID140809
-
Molecular Construction
-
N-term
-
10*His
-
SRXN1 (M1-S120)
Accession # Q9BYN0 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SRXN1; YKL086W; Prev. C20orf139; Sulfiredoxin 1 Homolog (S. Cerevisiae); SRX1; Chromosome 20 Open Reading Frame 139; Npn3; HBV PreS1-Transactivated Protein 5; Srx; CDNA FLJ25552 Fis, Clone JTH02127; Sulfiredoxin-1; PS1TP5; Sulphiredoxin; SRX; DJ850E9.2; S
-
AA Sequence
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS
-
Predicted Molecular Mass
19.9 kDa
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
