ST2/IL1RL1 Protein, Human (HEK293)
ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (HEK293) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (HEK293) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with tag free.
ST2/IL1RL1 protein serves as a potent inhibitor of IL-33 signaling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q01638-2 (K19-F328)
-
Molecular Construction
-
N-term
-
ST2 (K19-F328)
Accession # Q01638-2 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL1RL1; ST2V; Interleukin 1 Receptor Like 1; Homolog Of Mouse Growth Stimulation-Expressed; DER4; Suppressor Of Tumorigenicity 2; ST2; Interleukin 1 Receptor-Like 1 Isoform 2; T1; Interleukin 1 Receptor-Like 1 Isoform 1; Interleukin-1 Receptor-Like 1; Int
-
AA Sequence
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF
-
Predicted Molecular Mass
35.6 kDa
-
Molecular Weight
Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
