Copy Link Print Information

Staphylokinase Protein, Staphylococcus phage (His)

Customer Review

Based on 1 Customer Validation

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Staphylokinase Protein, Staphylococcus phage (His)
  • Staphylokinase Protein, Staphylococcus phage (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Background

Staphylokinase Protein emerges as a potent plasminogen activator, facilitating the conversion of plasminogen into its active form, plasmin. This enzymatic process is pivotal in the fibrinolytic system, as Staphylokinase not only serves as an activator but also forms a 1:1 complex with plasmin. In this complex, plasmin is activated and gains the ability to further catalyze the conversion of additional plasminogen molecules. The intricate interplay between Staphylokinase and plasmin underscores the protein's role as a key regulator in the fibrinolytic cascade, contributing to the dissolution of blood clots and highlighting its potential therapeutic applications in promoting clot resolution.

Verified Bioactivity

Fully biologically active when compared to standard. The specific activity determined by using chromogenic substrate s-2251 that incubate at 37°C for 10 minutes is 5.30 × 104 IU/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-6*His
  • Accession

    P15240 (S28-K163)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • 6*His
    • Staphylokinase (S28-K163)
      Accession # P15240
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLK4; Non-Specific Serine/Threonine Protein Kinase; Prev. STK18; Polo-Like Kinase 4 (Drosophila); Serine/Threonine-Protein Kinase PLK4; Serine/Threonine Kinase 18; Polo-Like Kinase 4; Snk Akin Kinase; Sak; MCCRP2; Serine/Threonine-Protein Kinase Sak; PLK-

  • AA Sequence

    SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 6.8, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Staphylokinase Protein, Staphylococcus phage (His) Product Image
    1/16
  • Experimental Validation Results for Staphylokinase Protein, Staphylococcus phage (His)
  • Staphylokinase Protein, Staphylococcus phage (His) Product Image