Staphylokinase Protein, S. aureus

Customer Review

Based on 1 Customer Validation

Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Staphylococcus aureus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.

Background

Staphylokinase Protein is a potent plasminogen activator that efficiently converts plasminogen into plasmin, an active enzyme involved in fibrinolysis. It forms a 1:1 complex with plasmin, and this complex further activates additional plasminogen molecules, amplifying the fibrinolytic cascade.

Verified Bioactivity

The specific activity determined by fibrining lysis in agarose plate is >5.0 × 104 IU/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Staphylococcus aureus
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Staphylokinase (S28-K163)
      Accession # P68802
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLK4; Non-Specific Serine/Threonine Protein Kinase; Prev. STK18; Polo-Like Kinase 4 (Drosophila); Serine/Threonine-Protein Kinase PLK4; Serine/Threonine Kinase 18; Polo-Like Kinase 4; Snk Akin Kinase; Sak; MCCRP2; Serine/Threonine-Protein Kinase Sak; PLK-

  • AA Sequence

    SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00