STRADA Protein, Human (sf9, His, GST)
STRADA Protein, Human (sf9, His, GST) is the recombinant human-derived STRADA, expressed by sf9 insect cells , with His, GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
STRADA Protein, Human (sf9, His, GST) is the recombinant human-derived STRADA, expressed by sf9 insect cells , with His, GST labeled tag. ,
Background
STRADA is a pseudokinase that, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. It adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting the conformational change of STK11/LKB1 into an active conformation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;GST
-
Accession
Q7RTN6-1 (S2-F431)
-
Gene ID92335
-
Protein Length
Full Length of Isoform-1
-
Synonyms
STRADA; STE20-Related Kinase Adaptor Alpha; STE20 Related Adaptor Alpha; STE20-Related Adapter Protein; STRAD; STE20-Like Pseudokinase; LYK5; STRAD Alpha; STE20-Related Kinase Adapter Protein Alpha; STLK5; NY-BR-96; Protein Kinase LYK5; Stlk; PMSE; Serolo
-
AA Sequence
SFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF
-
Predicted Molecular Mass
76 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
