1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Protein Tyrosine Kinases TK
  4. Syk
  5. SYK Protein, Human (sf9, His)

SYK protein is a non-receptor tyrosine kinase that mediates signal transduction across different receptors, including B-cell receptors (BCR), affecting innate and adaptive immunity, cell adhesion, and osteoclast maturation , platelet activation and vascular development. SYK forms complexes with activated receptors, phosphorylates downstream effectors, and is critical in BCR and T cell receptor signaling. SYK Protein, Human (sf9, His) is the recombinant human-derived SYK protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SYK protein is a non-receptor tyrosine kinase that mediates signal transduction across different receptors, including B-cell receptors (BCR), affecting innate and adaptive immunity, cell adhesion, and osteoclast maturation , platelet activation and vascular development. SYK forms complexes with activated receptors, phosphorylates downstream effectors, and is critical in BCR and T cell receptor signaling. SYK Protein, Human (sf9, His) is the recombinant human-derived SYK protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

SYK Protein, a non-receptor tyrosine kinase, serves as a critical mediator of signal transduction downstream of various transmembrane receptors, including classical immunoreceptors like the B-cell receptor (BCR). Its regulatory influence spans multiple biological processes, encompassing innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation, and vascular development. SYK assembles into signaling complexes with activated receptors at the plasma membrane, facilitated by the interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. This association can also occur indirectly through adapter proteins containing ITAM or partial hemITAM domains. Typically, SRC subfamily kinases mediate the phosphorylation of ITAM domains upon receptor engagement, although ITAM-independent signal transduction by SYK is observed more rarely. SYK directly phosphorylates downstream effectors, including DEPTOR, VAV1, PLCG1, PI-3-kinase, LCP2, and BLNK. Initially identified for its essential role in BCR signaling, SYK is indispensable for B-cell maturation, particularly at the pro-B to pre-B transition. Upon BCR engagement, it phosphorylates and activates BLNK, PLCG1, and the PKC signaling pathway, regulating B-cell antigen receptor (BCR)-coupled signaling. Beyond its role in BCR signaling, SYK plays a crucial role in T-cell receptor signaling and participates in the innate immune response against fungal, bacterial, and viral pathogens. Activated by the membrane lectin CLEC7A, SYK induces immune cell responses, including the production of reactive oxygen species (ROS), inflammasome activation, and NF-kappa-B-mediated transcription. SYK also regulates neutrophil degranulation and phagocytosis, mediates dendritic cell activation, and is involved in mast cell activation. Furthermore, SYK functions downstream of receptors mediating cell adhesion, influencing integrin-mediated activation of neutrophils and macrophages, P-selectin receptor/SELPG-mediated leukocyte recruitment to inflammatory sites, and non-immune processes such as vascular development and osteoclast function. It plays a pivotal role in platelet activation, being activated by collagen, fibrinogen-engaged ITGB3, and the membrane lectin CLEC1B, ultimately contributing to platelet adhesion and cytokine production. Together with CEACAM20, SYK enhances the production of the cytokine CXCL8/IL-8 via the NFKB pathway, suggesting a potential role in the intestinal immune response.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

P43405-1 (E356-N635)

Gene ID

6850

Molecular Construction
N-term
8*His
SYK (E356-N635)
Accession # P43405-1
C-term
Protein Length

Partial

Synonyms
SYK; Tyrosine-protein kinase SYK; Spleen tyrosine kinase; p72-Syk
AA Sequence

EEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SYK Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SYK Protein, Human (sf9, His)
Cat. No.:
HY-P701637
Quantity:
MCE Japan Authorized Agent: