Syndecan-2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Syndecan-2 protein has a PDZ domain and the same protein-binding activity, regulates dendritic morphogenesis, is located primarily in neuronal cell bodies and synapses, and predicts cell surface activity. Its genes show ubiquitous expression, with prominent presence in structures such as the skull, embryonic stroma, genitourinary system, jaws, and retina. Syndecan-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Syndecan-2 protein has a PDZ domain and the same protein-binding activity, regulates dendritic morphogenesis, is located primarily in neuronal cell bodies and synapses, and predicts cell surface activity. Its genes show ubiquitous expression, with prominent presence in structures such as the skull, embryonic stroma, genitourinary system, jaws, and retina. Syndecan-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Syndecan-2 protein is predicted to possess PDZ domain binding activity and identical protein binding activity. It plays a role in the regulation of dendrite morphogenesis and is predicted to be located in the neuronal cell body and synapse, with activity on the cell surface. The gene is expressed ubiquitously in various structures, including the cranium, embryo mesenchyme, genitourinary system, jaw, and retina. Syndecan-2, the human ortholog of this gene, has been implicated in cleft lip and cleft palate, highlighting its potential significance in developmental processes. In the reference dataset, it demonstrates widespread expression, including in the adult bladder, embryonic limb at E14.5, and various other tissues.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P43407/NP_032330.1 (E19-F141)
-
Molecular Construction
-
N-term
-
Syndecan-2 (E19-F141)
Accession # P43407/NP_032330.1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SDC2; Heparan Sulfate Proteoglycan 1, Cell Surface-Associated; Prev. HSPG1; Syndecan Proteoglycan 2; Prev. HSPG; Syndecan-2; Fibroglycan; Cell Surface-Associated Heparan Sulfate Proteoglycan 1; SYND2; CD362 Antigen; CD362; Syndecan; Syndecan 2; Heparan Su
-
AA Sequence
ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLF
-
Predicted Molecular Mass
14.8 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
