T4 gp32 Protein, T4 phage (His)
T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His) is the recombinant T4 gp32 protein, expressed by E. coli , with N-6*His labeled tag. T4 gp32 Protein, T4 phage (His), has molecular weight of ~33.5 kDa.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His) is the recombinant T4 gp32 protein, expressed by E. coli , with N-6*His labeled tag. T4 gp32 Protein, T4 phage (His), has molecular weight of ~33.5 kDa.
Background
T4 gp32, a single-stranded DNA-binding protein, actively participates in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it coats the lagging-strand single-stranded DNA, providing essential support to the advancing replication fork. This versatile protein stimulates the activities of the viral DNA polymerase and the DnaB-like SF4 replicative helicase, likely through its interaction with the helicase assembly factor. T4 gp32, in collaboration with the replicative helicase and the helicase assembly factor, facilitates the pairing of homologous DNA molecules, mediates homologous DNA strand exchange, and promotes the formation of joint molecules. Acting as an mRNA-specific autogenous translational repressor, T4 gp32 exhibits a dynamic oligomeric state, forming homodimers in the absence of DNA and monomers upon DNA binding. It is an integral part of the replicase complex, contributing to the coordination of DNA replication machinery, including the DNA polymerase, polymerase clamp, clamp loader complex, primase, DnaB-like SF4 replicative helicase, and the helicase assembly factor. Additionally, T4 gp32 interacts with viral SF1 dDA helicase and viral SF2 UvsW repair helicase, highlighting its central role in orchestrating viral DNA processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
P03695 Sequence information is not available or disclosed for this product.
-
Gene ID1258602 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
T4 gp32
Accession # P03695 -
C-term
-
-
Synonyms
SSB; Sjoegren Syndrome Type B Antigen; Small RNA Binding Exonuclease Protection Factor La; Sjogren Syndrome Antigen B; Lupus La Protein; La Ribonucleoprotein; La Autoantigen; SS-B; La/SSB; Sjogren Syndrome Antigen B (Autoantigen La); LARP3; Lupus La Antigen; La; SS-B/La Protein; La Ribonucleoprotein Domain Family, Member 3; Autoantigen La
-
AA Sequence
MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)