TAF1 Protein, Human (BD2, GST)
TAF1 Protein, Human (BD2, GST) is the recombinant human-derived TAF1, expressed by E. coli , with N-GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TAF1 Protein, Human (BD2, GST) is the recombinant human-derived TAF1, expressed by E. coli , with N-GST labeled tag. ,
Background
TAF1 is the largest component and core scaffold of the TFIID basal transcription factor complex, involved in nucleating complex assembly. TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, promoting assembly of the pre-initiation complex (PIC). TAF1 forms a promoter DNA binding subcomplex of TFIID together with TAF7 and TAF2. It contains novel N- and C-terminal Ser/Thr kinase domains that can autophosphorylate or transphosphorylate other transcription factors, such as phosphorylating TP53 at Thr-55 leading to MDM2-mediated degradation of TP53, and phosphorylating GTF2A1 and GTF2F1 at Ser residues. TAF1 also possesses DNA-binding activity and is essential for progression of the G1 phase of the cell cycle. Additionally, TAF1 exhibits histone acetyltransferase activity towards histones H3 and H4.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P21675-2 (L1519 -E1651)
-
Gene ID6872
-
Molecular Construction
-
N-term
-
GST
-
TAF1 (L1519 -E1651)
Accession # P21675-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TAF1; TAF(II)250; Prev. TAF2A; P250; Prev. BA2R; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, A, 250kD; Prev. CCG1; Transcription Initiation Factor TFIID 250 KDa Subunit; Prev. CCGS; Transcription Initiation Factor TFIID Subunit; P
-
AA Sequence
LLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE
-
Predicted Molecular Mass
42.2 kDa
-
Molecular Weight
Approximately 35-37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)