TAF1 Protein, Human (BD2, His)

TAF1 Protein, Human (BD2, His) is the recombinant human-derived TAF1, expressed by E. coli , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TAF1 Protein, Human (BD2, His) is the recombinant human-derived TAF1, expressed by E. coli , with N-6*His labeled tag. ,

Background

TAF1 is the largest component and core scaffold of the TFIID basal transcription factor complex, involved in nucleating complex assembly. TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, promoting assembly of the pre-initiation complex (PIC). TAF1 forms a promoter DNA binding subcomplex of TFIID together with TAF7 and TAF2. It contains novel N- and C-terminal Ser/Thr kinase domains that can autophosphorylate or transphosphorylate other transcription factors, such as phosphorylating TP53 at Thr-55 leading to MDM2-mediated degradation of TP53, and phosphorylating GTF2A1 and GTF2F1 at Ser residues. TAF1 also possesses DNA-binding activity and is essential for progression of the G1 phase of the cell cycle. Additionally, TAF1 exhibits histone acetyltransferase activity towards histones H3 and H4.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • TAF1 (L1519 -E1651)
      Accession # P21675-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TAF1; TAF(II)250; Prev. TAF2A; P250; Prev. BA2R; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, A, 250kD; Prev. CCG1; Transcription Initiation Factor TFIID 250 KDa Subunit; Prev. CCGS; Transcription Initiation Factor TFIID Subunit; P

  • AA Sequence

    LLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 15-17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00