1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. TDG Protein, Human (His)

TDG Protein, Human (His) is the recombinant human-derived TDG, expressed by E. coli , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TDG Protein, Human (His) is the recombinant human-derived TDG, expressed by E. coli , with N-10*His labeled tag.

Background

TDG is a DNA glycosylase that plays a key role in active DNA demethylation by specifically recognizing and binding 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) at CpG sites, mediating their excision through base-excision repair (BER) to install an unmethylated cytosine. It cannot remove 5-hydroxymethylcytosine (5hmC). Alternatively, it may participate in DNA demethylation by acting on 5-hydroxymethyluracil (5hmU) produced from 5hmC deamination. It also functions in DNA repair as a thymine-DNA glycosylase, correcting G/T mispairs to G/C pairs—hydrolytic deamination of 5-methylcytosine to thymine in higher eukaryotes leads to G/T mismatches. Its role in repairing canonical base damage is minor compared to DNA demethylation. TDG hydrolyzes the carbon-nitrogen bond between the DNA sugar-phosphate backbone and mispaired thymine. Beyond G/T, it excises thymine from C/T and T/T mispairs with activity order G/T >> C/T > T/T. It shows no activity on apyrimidinic sites and does not remove thymine from A/T pairs or single-stranded DNA. Additionally, it can excise uracil and 5-bromouracil from mispairs with guanine.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized TDG at 2μg/mL (100μL/well) can bind Anti-TDG antibody. The ED50 for this effect is 22.12 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized TDG at 2 μg/mL (100 μL/well) can bind Anti-TDG antibody. The ED50 for this effect is 22.12 ng/mL.
Species

Human

Source

E. coli

Tag

N-10*His

Accession

Q13569 (M1-A410)

Gene ID

6996

Protein Length

Full Length

Synonyms
G/T mismatch-specific thymine DNA glycosylase; Thymine-DNA glycosylase; EC:3.2.2.29
AA Sequence

MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

Predicted Molecular Mass
46.1 kDa
Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 1 mM DTT, 0.01% SKL.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TDG Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TDG Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TDG Protein, Human (His)
Cat. No.:
HY-P702783
Quantity:
MCE Japan Authorized Agent: