TDG Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TDG Protein, Human (His) is the recombinant human-derived TDG, expressed by E. coli , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TDG Protein, Human (His) is the recombinant human-derived TDG, expressed by E. coli , with N-10*His labeled tag.

Background

TDG is a DNA glycosylase that plays a key role in active DNA demethylation by specifically recognizing and binding 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) at CpG sites, mediating their excision through base-excision repair (BER) to install an unmethylated cytosine. It cannot remove 5-hydroxymethylcytosine (5hmC). Alternatively, it may participate in DNA demethylation by acting on 5-hydroxymethyluracil (5hmU) produced from 5hmC deamination. It also functions in DNA repair as a thymine-DNA glycosylase, correcting G/T mispairs to G/C pairs—hydrolytic deamination of 5-methylcytosine to thymine in higher eukaryotes leads to G/T mismatches. Its role in repairing canonical base damage is minor compared to DNA demethylation. TDG hydrolyzes the carbon-nitrogen bond between the DNA sugar-phosphate backbone and mispaired thymine. Beyond G/T, it excises thymine from C/T and T/T mispairs with activity order G/T >> C/T > T/T. It shows no activity on apyrimidinic sites and does not remove thymine from A/T pairs or single-stranded DNA. Additionally, it can excise uracil and 5-bromouracil from mispairs with guanine.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized TDG at 2μg/mL (100μL/well) can bind Anti-TDG antibody. The ED50 for this effect is 22.12 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    TDG; Thymine-DNA Glycosylase; Thymine DNA Glycosylase; HTDG; G/T Mismatch-Specific Thymine DNA Glycosylase; TDG Protein

  • AA Sequence

    MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

  • Predicted Molecular Mass

    46.1 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 1 mM DTT, 0.01% SKL.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00