TERT Protein, Human (His)
TERT Protein, Human (His) is the recombinant human-derived TERT protein, expressed by E. coli, with N-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TERT Protein, Human (His) is the recombinant human-derived TERT protein, expressed by E. coli, with N-6*His tag.
Background
TERT is the catalytic subunit of telomerase, a ribonucleoprotein enzyme critical for chromosome end replication in most eukaryotes. It is active in progenitor and cancer cells but exhibits minimal or no activity in normal somatic cells. As the core component of the telomerase holoenzyme complex, TERT elongates telomeres by functioning as a reverse transcriptase that adds TTAGGG repeats to chromosomal termini using an internal RNA template. Its catalytic cycle involves primer binding, extension, and product release upon reaching template boundaries. TERT shows higher activity on substrates containing 2-3 telomeric repeats, with regulation mediated by associated proteins, chaperones, and post-translational modifications. It also modulates Wnt signaling and plays pivotal roles in aging and antiapoptosis processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O14746-1 (E281-A436)
-
Gene ID7015
-
Molecular Construction
-
N-term
-
6*His
-
TERT (E281-A436)
Accession # O14746-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TERT; Telomerase Catalytic Subunit; Telomerase Reverse Transcriptase; Telomerase-Associated Protein 2; HEST2; PFBMFT1; TCS1; DKCA2; EST2; DKCB4; TRT; CMM9; TP2; HTRT
-
AA Sequence
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
-
Predicted Molecular Mass
22.7 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)