TFF3 Protein, Human
Based on 1 Customer Validation
TFF-3 Protein, Human is a regulatory peptide involved in mucosal protection and repair in the gastrointestinal tract.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
TFF-3 Protein, Human is a regulatory peptide involved in mucosal protection and repair in the gastrointestinal tract.
Human Trefoil Factor-3 is a regulatory peptide involved in mucosal protection and repair in the gastrointestinal tract. TFF3 is predominantly present in the mucous cells of the small and large intestine. TFF3 also has potential therapeutic role of in NEC[1].
The ED50 is <10 μg/mL as measured by human MCF-7 cells, corresponding to a specific activity of >100 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q07654 (E22-F80)
-
Molecular Construction
-
N-term
-
TFF3 (E22-F80)
Accession # Q07654 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFF3; Polypeptide P1.B; Trefoil Factor 3; TFI; ITF; Intestinal Trefoil Factor; HITF; HP1.B; Trefoil Factor 3 (Intestinal); P1B
-
AA Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
-
Predicted Molecular Mass
6.6 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)