Copy Link Print Information

TFF2 Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TFF2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TFF2 (Trefoil Factor 2) functions as an inhibitor of gastrointestinal motility and gastric acid secretion. It is postulated to serve as a structural constituent of gastric mucus, potentially contributing to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains, thereby playing a role in maintaining the integrity of the gastric mucosal barrier.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q03404 (E24-Y129)

  • Gene ID
    21785  [NCBI]
  • Molecular Construction
    • N-term
    • TFF2 (E24-Y129)
      Accession # Q03404
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TFF2; Spasmolytic Protein 1; Prev. SML1; SP; Spasmolytic Polypeptide; Trefoil Factor 2; Spasmolysin

  • AA Sequence

    EKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY

  • Predicted Molecular Mass

    12.7 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TFF2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • TFF2 Protein, Mouse (HEK293, His) Product Image