TFPI Protein, Mouse (HEK293, C-His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

TFPI protein serves as a potent inhibitor in the coagulation cascade by directly inhibiting factor X (Xa). In a Xa-dependent manner, it further inhibits the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. Beyond its role in antithrombotic action, TFPI exhibits the capability to associate with lipoproteins in plasma, suggesting its involvement in regulating hemostasis and clotting processes.

Measured by its ability to inhibit the proliferation of A549 human non-small cell lung cancer cells. The ED₅₀ this effect is 36.62 ng/mL, corresponding to a specific activity is 3.731×10⁴ units/mg.

Mouse

HEK293

C-10*His

O54819-1 (L29-K289)

21788  [NCBI]

Partial

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Approximately 42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.