Copy Link Print Information

Thioredoxin/TRX Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Thioredoxin/TRX proteins participate in multiple redox reactions, utilizing their reactive dithiol centers for reversible oxidation and disulfide bond formation.It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide.Thioredoxin/TRX Protein, Mouse is the recombinant mouse-derived Thioredoxin/TRX protein, expressed by E.coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Thioredoxin/TRX Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Thioredoxin/TRX proteins participate in multiple redox reactions, utilizing their reactive dithiol centers for reversible oxidation and disulfide bond formation.It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide.Thioredoxin/TRX Protein, Mouse is the recombinant mouse-derived Thioredoxin/TRX protein, expressed by E.coli , with tag free.

Background

Thioredoxin/TRX Protein is actively involved in diverse redox reactions, utilizing its active center dithiol to undergo reversible oxidation and disulfide formation, thereby catalyzing essential dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a crucial role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it nitrosylates the active site cysteine of CASP3 in response to nitric oxide, effectively inhibiting caspase-3 activity. Moreover, Thioredoxin demonstrates regulatory influence over the FOS/JUN AP-1 DNA binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its redox state. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, underscoring its multifaceted role in cellular processes beyond redox regulation.

Verified Bioactivity

Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 9.72 A650/min/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P10639 (M1-A105)

  • Gene ID
    22166  [NCBI]
  • Molecular Construction
    • N-term
    • TRX (M1-A105)
      Accession # P10639
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    TXN; TRDX; TRX; TRX1; Thioredoxin; Trx; ATL-derived factor; ADF; Surface-associated sulphydryl protein; SASP; TXN Delta 3; Thioredoxin-2; Allergen Hom S Trx; Thioredoxin Delta 3; Thioredoxin, Mitochondrial; Testicular Tissue Protein Li 199; ADF; Surface-A

  • AA Sequence

    MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA

  • Predicted Molecular Mass

    11.7 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Thioredoxin/TRX Protein, Mouse Product Image
    1/16
  • Thioredoxin/TRX Protein, Mouse Product Image