THSD1 Protein, Mouse (HEK293, His)

THSD1 protein actively regulates the assembly of nascent focal adhesions and affects the attachment of endothelial cells to the extracellular matrix. As a key player, THSD1 forms a complex with PTK2/FAK1, TLN1 and VCL and contributes to focal adhesion dynamics. THSD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived THSD1 protein, expressed by HEK293 , with C-His labeled tag.

THSD1 emerges as a positive regulator in the assembly of nascent focal adhesions, exerting its influence on the modulation of endothelial cell attachment to the extracellular matrix. As a key participant in this cellular process, THSD1 forms a complex with PTK2/FAK1, TLN1, and VCL, collectively contributing to the intricate orchestration of focal adhesion dynamics. The interaction between THSD1 and TLN1 underscores its involvement in the molecular machinery governing cell-matrix interactions, highlighting its significance in the regulation of focal adhesion formation and endothelial cell adhesion to the extracellular matrix.

Mouse

HEK293

C-His

Q9JM61/NP_062522.1 (E25-N412)

56229  [NCBI]

Extracellular Domain

EYLLLQEPVHVALSDRTVSVGFHYLSDVNGTLRNVSVMLWEANTNRTLTTKYLLTNQAQGTLQFECFYFKEAGDYWFVMIPEVTDNGTQVPLWEKSAFLKVEWPVFHIDLNRTAKAAEGTFQVGVFTTQPLCLFPVDKPDMLVDVIFTDRLPEARASLGQPLEIRASKRTKLTQGQWVEFGCAPVGVEAYVTVMLRLLGQDSVIASTGPIDLAQKFGYKLMMAPEVTCESVLEVMVLPPPCVFVQGVLAVYKEAPKRPEERTFQVAENRLPLGERRTVFNCTLFDVGKNKYCFNFGIVKKGHFSAKECMLIQRNIETWGPWQPWSPCSTTCGDAVRERRRLCVTSFPSRPSCSGMSSETSPCSLEECAVFRPPGPSPVSPQDPVKSNN

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.