TIGIT Protein, Mouse (Biotinylated, HEK293, His-Avi)
TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TIGIT protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived TIGIT protein, expressed by HEK293, with N-Avi labeled tag.
Background
TIGIT protein, characterized by its signaling receptor binding activity, operates upstream of negative regulation of T cell activation. Predicted to be active on the cell surface, this protein, orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains), is associated with the modulation of T cell responses. The expression of TIGIT is biased, with notable levels observed in the large intestine, small intestine, and several other tissues, emphasizing its potential role in immune regulation within these contexts.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
NP_001139797 (G26-T143)
-
Gene ID100043314
-
Molecular Construction
-
N-term
-
TIGIT (G26-T143)
Accession # NP_001139797 -
His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
TIGIT; DKFZp667A205; Prev. VSIG9; FLJ39873; Prev. VSTM3; V-Set And Immunoglobulin Domain Containing 9; V-Set And Transmembrane Domain-Containing Protein 3; Washington University Cell Adhesion Molecule; T-Cell Immunoreceptor With Ig And ITIM Domains; V-Set
-
AA Sequence
GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT
-
Predicted Molecular Mass
30.2 kDa
-
Molecular Weight
Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
