TIMP-2 Protein, Mouse (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Tissue inhibitor of metalloproteinases-2 (TIMP-2) is a protein that forms complexes with metalloproteinases, including collagenases, leading to the irreversible inactivation of these enzymes by binding to their catalytic zinc cofactor. Notably, TIMP-2 exhibits a specific interaction with matrix metalloproteinase 2 (MMP2) through its C-terminal region. This interaction, particularly with the C-terminal PEX domain of MMP2, results in the inhibition of MMP2 activity. TIMP-2's ability to regulate metalloproteinases underscores its significance in controlling extracellular matrix remodeling, with implications for various physiological and pathological processes. (

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 34.88 ng/mL, corresponding to a specific activity is 2.87×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 34.88 ng/mL, corresponding to a specific activity is 2.87×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TIMP-2 (C27-P220)
      Accession # P25785
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TIMP2; Tissue Inhibitor Of Metalloproteinase 2; TIMP Metallopeptidase Inhibitor 2; Testicular Secretory Protein Li 57; CSC-21K; TIMP-2; Tissue Inhibitor Of Metalloproteinases 2; DDC8; Metalloproteinase Inhibitor 2

  • AA Sequence

    CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

  • Predicted Molecular Mass

    22.6 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00