TLR4 Protein, Human (sf9, His, Solution)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

Background

TLR4, a transmembrane receptor, operates as a pattern recognition receptor, detecting pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to initiate innate immune responses. At the plasma membrane, it collaborates with LY96 to recognize bacterial lipopolysaccharide (LPS), triggering an immune response. Moreover, TLR4 is involved in LPS-independent inflammatory responses induced by free fatty acids and Ni(2+). The receptor acts through signaling pathways involving MYD88, TIRAP, and TRAF6, leading to NF-kappa-B activation and cytokine secretion. Additionally, CD14-mediated TLR4 internalization via endocytosis initiates a MYD88-independent signaling pathway through the TICAM1-TBK1-IRF3 axis, resulting in type I interferon production. TLR4 activation also leads to the activation of the NLRP3 inflammasome and a positive feedback loop between autophagy and the NF-kappa-B signaling cascade. In complex with TLR6, TLR4 promotes inflammation in monocytes/macrophages, and ligand binding triggers internalization and an inflammatory response. TLR4's diverse interactions, including those with LY96, MYD88, TIRAP, TICAM2, NOX4, CNPY3, HSP90B1, CD36, WDFY1, SMPDL3B, CEACAM1, RFTN1, SCIMP, TRAF3IP3, and TREM1, further highlight its pivotal role in orchestrating immune responses and cellular signaling.

Verified Bioactivity

1. Immobilized Recombinant Human TLR4/ CD284 Protein at 1 μg/mL (100 μL/well) on His Tag Antibody, Mouse MAb precoated (5 μg/mL, 100 μL/well) can bind Anti-TLR4 Antibody, the EC50 is 0.8-15 ng/mL.
2. Immobilized Human TLR4 at 2 µg/mL (100 µL/well) can bind bind biotinylated recombinant Human MD2 Protein (HY-P79098). The ED50 for this effect is 0.03486 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human TLR4 at 2 µg/mL (100 µL/well) can bind bind biotinylated recombinant Human MD2 Protein. The ED50 for this effect is 0.03486 μg/mL.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TLR4 (E24-K631)
      Accession # O00206-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TLR4; CD284; Toll Like Receptor 4; Toll Like Receptor 4 Protein; Toll-Like Receptor 4; Homolog Of Drosophila Toll; HToll; CD284 Antigen; TLR-4; TOLL; ARMD10

  • AA Sequence

    ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

  • Predicted Molecular Mass

    70.5 kDa

  • Molecular Weight

    Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Monomer

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 6.0, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00