TMCO1 Protein, Human (Cell-Free, His)
TMCO1 Protein, Human (Cell-Free, His) is the recombinant human-derived TMCO1 protein, expressed by E. coli cell-free system, with N-10*His tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TMCO1 Protein, Human (Cell-Free, His) is the recombinant human-derived TMCO1 protein, expressed by E. coli cell-free system, with N-10*His tag.
Background
TMCO1 is an endoplasmic reticulum (ER) calcium-selective channel that prevents intracellular Ca2(+) stores from overfilling and maintains calcium homeostasis in the ER. In response to ER Ca2(+) overloading, TMCO1 assembles into a homotetramer, forming a functional calcium-selective channel that facilitates Ca2(+) release. It mediates ER Ca2(+) homeostasis in osteoblasts and plays a key role in bone formation via the CaMKII-HDAC4-RUNX2 signaling axis (by similarity). TMCO1 is a component of the multi-pass translocon (MPT) complex, which mediates the insertion of multi-pass membrane proteins into the lipid bilayer of membranes. The MPT complex takes over after the SEC61 complex: following membrane insertion of the first few transmembrane segments of proteins by the SEC61 complex, the MPT complex occludes the lateral gate of the SEC61 complex to promote insertion of subsequent transmembrane regions. Within the MPT complex, the GEL subcomplex may mediate the insertion of transmembrane regions into the membrane.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9UM00-1 (M1-S188)
-
Gene ID54499
-
Molecular Construction
-
N-term
-
10*His
-
TMCO1 (M1-S188)
Accession # Q9UM00-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
TMCO1; Xenogeneic Cross-Immune Protein PCIA3; Prev. TMCC4; Transmembrane And Coiled-Coil Domains Protein 4; Transmembrane And Coiled-Coil Domain-Containing Protein 1; Putative Membrane Protein; Calcium Load-Activated Calcium Channel; Alternative Protein T
-
AA Sequence
STMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
-
Predicted Molecular Mass
22.7 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
