Copy Link Print Information

TMPRSS1/HPN Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN, Human (HEK293, His, solution) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • TMPRSS1/HPN Protein, Human (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TMPRSS1/HPN is a serine protease that cleaves extracellular substrates and is involved in the proteolytic processing of growth factors such as HGF and MST1/HGFL. In addition to growth factor regulation, TMPRSS1/HPN is also critical for cell growth and morphology maintenance. TMPRSS1/HPN, Human (HEK293, His, solution) is the recombinant human-derived TMPRSS1/HPN protein, expressed by HEK293, with C-6*His labeled tag.

Background

TMPRSS1/HPN, a serine protease, is involved in the cleavage of various extracellular substrates, contributing to the proteolytic processing of growth factors such as HGF and MST1/HGFL. Beyond its role in growth factor regulation, TMPRSS1/HPN plays a significant part in cell growth and the maintenance of cell morphology. Additionally, this protease is implicated in the proteolytic processing of ACE2, emphasizing its involvement in crucial cellular pathways. Notably, TMPRSS1/HPN mediates the proteolytic cleavage of urinary UMOD, a process essential for the polymerization of UMOD, underscoring its multifunctional role in modulating various biological processes.

Verified Bioactivity

1.Immobilized Human HPN, His Tag at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-HPN Antibody, hFc Tag with the EC50 of 5.0-15.0 ng/mL determined by ELISA.
2.Measured by its ability to cleave tertbutoxycarbonyl-Gln-Arg-Arg-7-amino-4-methylcoumarin (Boc-QRR-AMC). The specific activity is 10000-100000 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    P05981 (R45-L417)

  • Gene ID
    3249
  • Molecular Construction
    • N-term
    • HPN (R45-L417)
      Accession # P05981
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    Serine protease hepsin; EC:3.4.21.106; Transmembrane protease serine 1; Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain; HPN; TMPRSS1

  • AA Sequence

    RSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

  • Predicted Molecular Mass

    42 kDa

  • Molecular Weight

    Approximately 18-22 kDa & 30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM NaAc,150 mM NaCl, pH 5.0.

Endotoxin Level

<0.5 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TMPRSS1/HPN Protein, Human (HEK293, His, solution) Product Image
    1/16
  • TMPRSS1/HPN Protein, Human (HEK293, His, solution) Product Image