TNFRSF3/LTBR Protein, Human (HEK293, His-Avi)
- Species: Human
- Source: HEK293
-
보관:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Technical Parameters
-
Product Properties
- 각종 서류
- Help & FAQs
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P36941-1 (Q31-M227)
-
Gene ID4055
-
Molecular Construction
-
N-term
-
LTBR (Q31-M227)
Accession # P36941-1 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
rHuTumor necrosis factor receptor superfamily member 3/TNFRSF3, His; Tumor Necrosis Factor Receptor Superfamily Member 3; Lymphotoxin-Beta Receptor; Tumor Necrosis Factor C Receptor; Tumor Necrosis Factor Receptor 2-Related Protein; Tumor Necrosis Factor Receptor Type III; TNF-RIII; TNFR-III; LTBR; D12S370; TNFCR; TNFR3; TNFRSF3
-
AA Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
-
Predicted Molecular Mass
25.3 kDa
-
분자량
Approximately 33-35 kDa & 37-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
각종 서류
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
