1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. TNIK Protein, Human (Active, sf9)

TNIK protein is a key activator of the Wnt signaling pathway and regulates gene expression by phosphorylating TCF4/TCF7L2 at the promoter of Wnt target genes. TNIK is located upstream of the JUN N-terminal pathway and contributes to the complex Wnt signaling cascade. TNIK Protein, Human (sf9) is the recombinant human-derived TNIK protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNIK protein is a key activator of the Wnt signaling pathway and regulates gene expression by phosphorylating TCF4/TCF7L2 at the promoter of Wnt target genes. TNIK is located upstream of the JUN N-terminal pathway and contributes to the complex Wnt signaling cascade. TNIK Protein, Human (sf9) is the recombinant human-derived TNIK protein, expressed by sf9 insect cells , with tag free.

Background

TNIK, a serine/threonine kinase, emerges as a pivotal activator of the Wnt signaling pathway, playing a crucial role in gene expression regulation. Its involvement extends to the phosphorylation of TCF4/TCF7L2 at promoters of Wnt target genes, thereby facilitating their activation. Positioned upstream of the JUN N-terminal pathway, TNIK contributes to the intricate cascade of Wnt signaling. Beyond its canonical functions, TNIK is implicated in the response to environmental stress and forms part of a signaling complex, comprising NEDD4, RAP2A, and TNIK, which orchestrates neuronal dendrite extension and arborization during development. In a broader context, TNIK exhibits potential roles in cytoskeletal rearrangements and the regulation of cell spreading. Notably, it exerts its influence by phosphorylating SMAD1 at Thr-322, thereby expanding its regulatory repertoire in diverse cellular processes.

Biological Activity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q9UKE5 (D11-G314)

Gene ID

23043

Molecular Construction
N-term
TNIK (D11-G314)
Accession # Q9UKE5
C-term
Protein Length

Partial

Synonyms
TNIK; TRAF2 and NCK-interacting protein kinase
AA Sequence

DEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRG

Predicted Molecular Mass
34.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 10% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TNIK Protein, Human (Active, sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNIK Protein, Human (Active, sf9)
Cat. No.:
HY-P701646
Quantity:
MCE Japan Authorized Agent: