Copy Link Print Information

TNIK Protein, Human (Active, sf9)

Customer Review

Based on 1 Customer Validation

TNIK protein is a key activator of the Wnt signaling pathway and regulates gene expression by phosphorylating TCF4/TCF7L2 at the promoter of Wnt target genes. TNIK is located upstream of the JUN N-terminal pathway and contributes to the complex Wnt signaling cascade. TNIK Protein, Human (sf9) is the recombinant human-derived TNIK protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • TNIK Protein, Human (Active, sf9) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TNIK protein is a key activator of the Wnt signaling pathway and regulates gene expression by phosphorylating TCF4/TCF7L2 at the promoter of Wnt target genes. TNIK is located upstream of the JUN N-terminal pathway and contributes to the complex Wnt signaling cascade. TNIK Protein, Human (sf9) is the recombinant human-derived TNIK protein, expressed by sf9 insect cells , with tag free.

Background

TNIK, a serine/threonine kinase, emerges as a pivotal activator of the Wnt signaling pathway, playing a crucial role in gene expression regulation. Its involvement extends to the phosphorylation of TCF4/TCF7L2 at promoters of Wnt target genes, thereby facilitating their activation. Positioned upstream of the JUN N-terminal pathway, TNIK contributes to the intricate cascade of Wnt signaling. Beyond its canonical functions, TNIK is implicated in the response to environmental stress and forms part of a signaling complex, comprising NEDD4, RAP2A, and TNIK, which orchestrates neuronal dendrite extension and arborization during development. In a broader context, TNIK exhibits potential roles in cytoskeletal rearrangements and the regulation of cell spreading. Notably, it exerts its influence by phosphorylating SMAD1 at Thr-322, thereby expanding its regulatory repertoire in diverse cellular processes.

Verified Bioactivity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession

    Q9UKE5 (D11-G314)

  • Gene ID
    23043
  • Molecular Construction
    • N-term
    • TNIK (D11-G314)
      Accession # Q9UKE5
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNIK; MAP4K7; TRAF2 And NCK Interacting Kinase; Non-Specific Serine/Threonine Protein Kinase; KIAA0551; MRT54; TRAF2 And NCK-Interacting Protein Kinase

  • AA Sequence

    DEIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRG

  • Predicted Molecular Mass

    34.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 10% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TNIK Protein, Human (Active, sf9) Product Image
    1/16
  • TNIK Protein, Human (Active, sf9) Product Image