TOP2A Protein, Human

TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.

Background

TOP2A is a key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules. It generates a double-stranded break in one of the strands, passes the intact strand through the broken strand, and religates the broken strand. Additionally, TOP2A may play a role in regulating the period length of BMAL1 transcriptional oscillation (By similarity).

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TOP2A (S1354-S1473)
      Accession # P11388-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TOP2A; DNA topoisomerase 2-alpha; TOP2; DNA topoisomerase II; alpha isozyme

  • AA Sequence

    SPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDD

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00