TOP2A Protein, Human
TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TOP2A Protein, Human is the recombinant human-derived TOP2A protein, expressed by E. coli, with tag free tag.
Background
TOP2A is a key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules. It generates a double-stranded break in one of the strands, passes the intact strand through the broken strand, and religates the broken strand. Additionally, TOP2A may play a role in regulating the period length of BMAL1 transcriptional oscillation (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P11388-1 (S1354-D1473)
-
Gene ID7153
-
Molecular Construction
-
N-term
-
TOP2A (S1354-S1473)
Accession # P11388-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TOP2A; DNA Topoisomerase 2-Alpha; Prev. TOP2; DNA Topoisomerase II, 170 KD; TOP2alpha; DNA Topoisomerase 2; TOPIIA; DNA Gyrase; Topoisomerase (DNA) II Alpha 170kDa; TP2A; DNA Topoisomerase II, Alpha Isozyme; DNA Topoisomerase II Alpha; DNA Topoisomerase (
-
AA Sequence
SPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDD
-
Predicted Molecular Mass
13 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
