TPP2 Protein, Human (Myc, His)
TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Background
The cytosolic tripeptidyl-peptidase TPP2 protein functions as a key component of the proteolytic cascade in the ubiquitin-proteasome pathway, acting downstream of the 26S proteasome. It plays a crucial role in intracellular amino acid homeostasis, functioning to release N-terminal tripeptides from polypeptides. Additionally, TPP2 protein has been implicated in stimulating adipogenesis, contributing to cellular processes involved in adipose tissue formation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
P29144 (D44-H264)
-
Molecular Construction
-
N-term
-
10*His
-
TPP2 (D44-H264)
Accession # P29144 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TPP2; TPPII; Tripeptidyl Peptidase 2; TPP-II; Tripeptidyl Aminopeptidase; TPP-2; Tripeptidyl-Peptidase II; Tripeptidyl Peptidase II; Tripeptidyl-Peptidase 2; IMD78
-
AA Sequence
DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH
-
Predicted Molecular Mass
31.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
