TPP2 Protein, Human (Myc, His)

TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

The cytosolic tripeptidyl-peptidase TPP2 protein functions as a key component of the proteolytic cascade in the ubiquitin-proteasome pathway, acting downstream of the 26S proteasome. It plays a crucial role in intracellular amino acid homeostasis, functioning to release N-terminal tripeptides from polypeptides. Additionally, TPP2 protein has been implicated in stimulating adipogenesis, contributing to cellular processes involved in adipose tissue formation.

Human

E. coli

N-His;C-Myc

P29144 (D44-H264)

7174  [NCBI]

Partial

DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.