TPPP3 Protein, Human (His)
Based on 1 Customer Validation
The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TPPP3 protein is a microtubule-associated regulator that exerts a critical influence on microtubule dynamics through bundling activity. Its important role extends to embryonic implantation and decidualization, implicated in reproductive events. TPPP3 Protein, Human (His) is the recombinant human-derived TPPP3 protein, expressed by E. coli , with N-His labeled tag.
Background
TPPP3, a microtubule-associated protein, assumes a pivotal role as a regulator of microtubule dynamics, exerting its influence through microtubule bundling activity. Its essential involvement extends to critical biological processes, notably embryo implantation and decidualization, suggesting a role in reproductive events. The impact on embryo implantation implies a potential regulatory function linked to beta-catenin, a key signaling molecule in cellular processes. Moreover, TPPP3's role in decidualization reinforces its significance in orchestrating cellular events, particularly through its influence on beta-catenin signaling. These findings underscore TPPP3 as a versatile player in cellular dynamics, with implications for fundamental processes in development and reproduction.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9BW30 (M1-K176)
-
Molecular Construction
-
N-term
-
His
-
TPPP3 (M1-K176)
Accession # Q9BW30 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TPPP3; P20; Tubulin Polymerization Promoting Protein Family Member 3; Tubulin Polymerization-Promoting Protein Family Member 3; P25gamma; TPPP/P20; CGI-38; Brain Specific Protein
-
AA Sequence
MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
