TRP1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu(2+) ions. This activity is inhibited by Zn(2+). TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu(2+) ions. This activity is inhibited by Zn(2+). TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag.
Background
TRP1 (Tyrosinase-related protein 1) plays a crucial role in melanin biosynthesis, as evidenced by its involvement in the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid, particularly in the presence of bound Cu(2+) ions. Notably, this enzymatic activity is inhibited in the presence of Zn(2+). TRP1 is implicated in regulating the type of melanin synthesized, thus influencing pigmentation processes. Additionally, to a lesser extent, TRP1 exhibits hydroxylating activity on tyrosine, contributing to melanin production. The multifaceted functions of TRP1 underscore its significance in melanogenesis and highlight its potential role in determining the characteristics of melanin generated in the skin.
Verified Bioactivity
Measured by its ability to catalyze the formation of dopachrome from L-dopa. The specific activity is 73.524 U/mg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated in activation buffer for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P17643 (Q25-R471)
-
Molecular Construction
-
N-term
-
TRP1 (Q25-R471)
Accession # P17643 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TYRP1; tyrosinase related protein 1; TRP; CAS2; CATB; GP75; OCA3; TRP1; TYRP; b-PROTEIN; brown; isa; MELANOMA ANTIGEN GP75; 5,6-Dihydroxyindole-2-Carboxylic Acid Oxidase; tyrosinase-related protein 1; TRP-1; Tyrp-1; TYRRP
-
AA Sequence
QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 60-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
