1. Recombinant Proteins
  2. Others
  3. TSC22/TSC22D1 Protein, Mouse (His)

TSC22D1 protein, possessing RNA polymerase II binding activity, regulates apoptotic and cell proliferation processes. It is found in the cytoplasm and nucleus and expressed in multiple structures like the alimentary system and central nervous system. With ubiquitous expression observed, TSC22D1 likely regulates diverse cellular processes across tissues. TSC22/TSC22D1 Protein, Mouse (His) is the recombinant mouse-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSC22D1 protein, possessing RNA polymerase II binding activity, regulates apoptotic and cell proliferation processes. It is found in the cytoplasm and nucleus and expressed in multiple structures like the alimentary system and central nervous system. With ubiquitous expression observed, TSC22D1 likely regulates diverse cellular processes across tissues. TSC22/TSC22D1 Protein, Mouse (His) is the recombinant mouse-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

Background

TSC22D1 protein is predicted to possess DNA-binding transcription activator activity, specifically for RNA polymerase II, and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Functioning upstream of processes like negative regulation of apoptotic process, positive regulation of apoptotic process, and positive regulation of cell population proliferation, it is found in both the cytoplasm and nucleus. The expression of TSC22D1 spans various structures, including the alimentary system, central nervous system, early conceptus, genitourinary system, and sensory organ. With ubiquitous expression observed in tissues like the adrenal gland and the central nervous system at embryonic day 14, TSC22D1 likely plays a regulatory role in diverse cellular processes across different tissues.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

NP_033392 (M1-A143)

Gene ID
Molecular Construction
N-term
His
TSC22/TSC22D1 (M1-A143)
Accession # NP_033392
C-term
Protein Length

Full Length

Synonyms
TSC22 domain family protein 1; Cerebral protein 2; KIAA1994; TGFB1I4
AA Sequence

MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA

Predicted Molecular Mass
17.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TSC22/TSC22D1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TSC22/TSC22D1 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSC22/TSC22D1 Protein, Mouse (His)
Cat. No.:
HY-P77259
Quantity:
MCE Japan Authorized Agent: