TSC22/TSC22D1 Protein, Mouse (His)
TSC22D1 protein, possessing RNA polymerase II binding activity, regulates apoptotic and cell proliferation processes. It is found in the cytoplasm and nucleus and expressed in multiple structures like the alimentary system and central nervous system. With ubiquitous expression observed, TSC22D1 likely regulates diverse cellular processes across tissues. TSC22/TSC22D1 Protein, Mouse (His) is the recombinant mouse-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TSC22D1 protein, possessing RNA polymerase II binding activity, regulates apoptotic and cell proliferation processes. It is found in the cytoplasm and nucleus and expressed in multiple structures like the alimentary system and central nervous system. With ubiquitous expression observed, TSC22D1 likely regulates diverse cellular processes across tissues. TSC22/TSC22D1 Protein, Mouse (His) is the recombinant mouse-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.
TSC22D1 protein is predicted to possess DNA-binding transcription activator activity, specifically for RNA polymerase II, and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Functioning upstream of processes like negative regulation of apoptotic process, positive regulation of apoptotic process, and positive regulation of cell population proliferation, it is found in both the cytoplasm and nucleus. The expression of TSC22D1 spans various structures, including the alimentary system, central nervous system, early conceptus, genitourinary system, and sensory organ. With ubiquitous expression observed in tissues like the adrenal gland and the central nervous system at embryonic day 14, TSC22D1 likely plays a regulatory role in diverse cellular processes across different tissues.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
NP_033392 (M1-A143)
-
Molecular Construction
-
N-term
-
His
-
TSC22/TSC22D1 (M1-A143)
Accession # NP_033392 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TSC22D1; KIAA1994; TGFB1I4; TSC22; hucep-2; TSC22 domain family protein 1; Cerebral protein 2; HUCEP-2; Regulatory protein TSC-22; TGFB-stimulated clone 22 homolog; Transforming growth factor beta-1-induced transcript 4 protein; Ptg-2; TGFbeta-Stimulated
-
AA Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
-
Predicted Molecular Mass
17.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
