TSLP Protein, Human (Biotinylated, HEK293, His-Avi)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

1. Immobilized Biotinylated Human TSLP His at 0.5 μg/mL (100μL/Well). Dose response curve for Anti-Human TSLP Ab hFc with the EC₅₀<62.7 ng/mL determined by ELISA.
2. Immobilized Anti-TSLP Antibody, hFc Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human TSLP, His Tag with the EC₅₀ ≤ 2.8 ng/mL determined by ELISA.

Human

HEK293

C-Avi;C-8*His

Q969D9-1 (Y29-Q159)

85480  [NCBI]

Full Length of Isoform-1 Mature Protein

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Approximately 12 kDa & 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.