TSLP Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.
Verified Bioactivity
1. Immobilized Biotinylated Human TSLP His at 0.5 μg/mL (100μL/Well). Dose response curve for Anti-Human TSLP Ab hFc with the EC50<62.7 ng/mL determined by ELISA.
2. Immobilized Anti-TSLP Antibody, hFc Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human TSLP, His Tag with the EC50 ≤ 2.8 ng/mL determined by ELISA.
3. Immobilized Biotinylated Human TSLP, His Avi Tag at 1 μg/mL (100 μL/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Human TSLPR, hFc Tag with the EC50 of ≤ 5.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q969D9-1 (Y29-Q159)
-
Molecular Construction
-
N-term
-
TSLP (Y29-Q159)
Accession # Q969D9-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP
-
AA Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 8-12 kDa & 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
