TSLP Protein, Mouse (HEK293, His)
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP, Mouse (HEK293, His) is the recombinant mouse-derived TSLP protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP, Mouse (HEK293, His) is the recombinant mouse-derived TSLP protein, expressed by HEK293, with C-His labeled tag.
Background
The TSLP (thymic stromal lymphopoietin) protein is a cytokine with diverse immunomodulatory functions. It induces the release of T-cell-attracting chemokines from monocytes and promotes the maturation of CD11c(+) dendritic cells, playing a crucial role in the regulation of immune responses. TSLP is known to have implications in allergic inflammation by directly activating mast cells, contributing to the complex network of allergic responses. TSLP exerts its effects by interacting with a receptor complex composed of CRLF2 and IL7R, and the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for recruiting IL7R to form the high-affinity ternary complex. These interactions highlight the intricate molecular mechanisms through which TSLP influences immune cell behavior, emphasizing its role in immune system regulation and allergic responses.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9JIE6 (Y20-E140)
-
Gene ID53603
-
Molecular Construction
-
N-term
-
TSLP (Y20-E140)
Accession # Q9JIE6 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP
-
AA Sequence
YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)