TSPO Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived TSPO protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived TSPO protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
TSPO (Translocator Protein) exhibits the ability to bind protoporphyrin IX, suggesting a potential role in the transport of porphyrins and heme. Initially identified as a peripheral-type benzodiazepine receptor, TSPO can also bind isoquinoline carboxamides. Moreover, it plays a role in promoting cholesterol transport across mitochondrial membranes, implicating its involvement in lipid metabolism. Although its precise physiological function is controversial and some reports suggest that it may not be essential for steroid hormone biosynthesis, TSPO interacts with various proteins such as TSPOAP1, MOST-1, and potentially STAR, indicating its participation in diverse cellular processes.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P50637 (M1-E169)
-
Gene ID12257
-
Molecular Construction
-
N-term
-
10*His
-
TSPO (M1-E169)
Accession # P50637 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Tspo; Bzrp; Mbr; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR; PBS; PBRS; PTBR; BPBS; Translocator Protein (18kDa); Benzodiazapine Receptor (Peripheral); Benzodiazepine Peripheral Binding
-
AA Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
-
Predicted Molecular Mass
21.7 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
