TTN Protein, Human (His)
The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag.
Background
TTN, a crucial player in the assembly and operation of vertebrate striated muscles, assumes a pivotal role by establishing connections at the individual microfilament level. This contribution becomes instrumental in maintaining the delicate balance of forces within the sarcomere halves. The size and extensibility of the cross-links, orchestrated by TTN, emerge as key determinants shaping the extensibility properties of the sarcomere and, consequently, muscle function. Beyond its myocentric duties, TTN extends its influence to non-muscle cells, where it appears to participate in vital processes such as chromosome condensation and segregation during mitosis. In this context, TTN's potential roles include acting as a link between the lamina network and chromatin or nuclear actin, or potentially both, during the interphase of the cell cycle. This multifaceted engagement underscores TTN's significance in both muscle physiology and cellular dynamics.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q8WZ42-6 (V5398-T5604)
-
Molecular Construction
-
N-term
-
His
-
TTN (V5398-T5604)
Accession # Q8WZ42-6 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TTN; Titin; EC 2.7.11.1; Connectin; Rhabdomyosarcoma antigen MU-RMS-40.14; SALMY; HMERF; EOMFC; CMYP5; CMYO5; TMD; CMH9; ; MYLK5 CMPD4; LGMDR10; LGMD2J; Transthyretin; Titin Fetal Isoform; Cardiomyopathy, Dilated 1G (Autosomal Dominant); CMD1G; FLJ32040
-
AA Sequence
VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT
-
Predicted Molecular Mass
26.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)