Tubulin cofactor A Protein, Human

The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.

Tubulin cofactor A Protein takes on a crucial role as a tubulin-folding protein, actively participating in the initial stage of the tubulin folding pathway. It is part of a supercomplex composed of cofactors A to E. Cofactors A and D play a pivotal role by capturing and stabilizing tubulin in a quasi-native conformation. The interaction of cofactor E with the cofactor D-tubulin complex facilitates the subsequent binding to cofactor C, leading to the release of tubulin polypeptides committed to adopting the native state. In orchestrating these intricate steps, Tubulin cofactor A Protein emerges as a key player in the early phases of tubulin folding, contributing to the formation of a functional and stable tubulin structure.

Human

E. coli

Tag Free

O75347 (M1-A108)

6902  [NCBI]

Full Length

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.5.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.