TWEAK/TNFSF12 Protein, Human (CHO)
Based on 3 publication(s) in Google Scholar
TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs). TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1. Human TWEAK protein is a type II transmembrane protein (M1-H249) with a transmembrane domain (22-42 a.a.). TWEAK/TNFSF12 Protein, Human (CHO) is the extracellular part (R99-H249) of TWEAK protein, produced by CHO cells with tag free.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis[1]. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs)[2]. TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1[3]. Human TWEAK protein is a type II transmembrane protein (M1-H249) with a transmembrane domain (22-42 a.a.). TWEAK/TNFSF12 Protein, Human (CHO) is the extracellular part (R99-H249) of TWEAK protein, produced by CHO cells with tag free.
Background
TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis. It is a multifunctional cytokine belonging to tumor necrosis factor (TNF) superfamily, acts function by binding TweakR/Fn14 receptor. TWEAK is a cell surface-associated type II transmembrane protein with 2 types protein chain: the membrane form and the secreted or soluble form. The soluble form derives from the membrane form by proteolytic processing. The protein sequences in human and mouse is very different with similarity of 24.79%[1].
TWEAK binds to FN14 and possibly also to TNRFSF12/APO3, is a weak inducer of apoptosis in some cell types. TWEAK mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells[2].
TWEAK has multiple biological activities, many of which are associated with immune system development and function[1].
TWEAK does have pro-apoptotic activity on a select group of human tumor cell lines and on monocytes, while it promotes cell proliferation in human vascular EC and SMC. Furthermore, FGF-2 co-treatment can potentiate TWEAK-stimulated HUVEC proliferation, an effect that may be due to the ability of FGF-2 to up-regulate TweakR/Fn14 gene expression. At the meanwhile TWEAK-TweakR/Fn14 autocrine signaling promotes human microvascular renal EC (HMREC) migration[1].
TWEAK also plays key role in inflammatory response. TWEAK, stimulates interleukin (IL)-8 secretion in human tumor cell lines, WI-38 fibroblasts and astrocytes. TWEAK also increases IL-6 secretion and ICAM-1 expression in astrocyte cell. Moreover, TWEAK co-incubation could potentiate the pro-inflammatory activities of TNF and IL-1, and concluded that TWEAK could be involved in the pathogenesis of chronic inflammatory diseases[3].
Above all, TWEAK involves in stimulation of cell growth and angiogenesis, induction of inflammatory cytokines, and under some experimental conditions, stimulation of apoptosis[1].
In Vitro
TWEAK (human; 100 ng/mL; changed media 3 times per week for 4 weeks) induces matrix metalloprotease (MMP) production in human chondrocytes[4].
TWEAK (human; 500 ng/mL; 24 h) and Fn14 interaction induces upregulation of ICAM-1 and E-selectin on HUVEC, also induces chemokine secretion by HUVEC[5].
TWEAK (human; 10-1000 ng/mL; 24-72 h) induces MCP-1 production in HMC in a dose- and time-dependent manner[6].
In Vivo
Fc-TWEAK (human; 200 μg/mouse; i.p.; twice weekly, dose at 0, 4, and 7 days) induces inflammatory gene expression and kidney cell proliferation in vivo in C57Bl/6 mice[6].
Verified Bioactivity
1.The ED50 is <1 ng/mL as measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.
2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 2.53 ng/mL.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Redox Biol
Macrophage AMPK activated by oxidative stress drives profibrotic crosstalk with tubular cells to accelerate renal fibrosis after ischemic and reperfusion injury. [Abstract]2026 Mar:90:104002. PMID: 41621245 -
Cell Rep
TWEAK-Fn14 signaling protects mice from pulmonary fibrosis by inhibiting fibroblast activation and recruiting pro-regenerative macrophages. [Abstract]2025 Jan 18;44(2):115220. PMID: 39827460 -
Toxicol Appl Pharmacol
Arctigenin relieves inflammation and remodels the nasal epithelial barrier function in allergic rhinitis via the KLF5/BIRC3/NFκB axis. [Abstract]2025 Nov:504:117510. PMID: 40803538
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
O43508-1/Q4ACW9 (R99-H249)
-
Molecular Construction
-
N-term
-
TWEAK (R99-H249)
Accession # O43508 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFSF12; TNLG4A; TNF Superfamily Member 12; TNF12; TWEAK; Tumor Necrosis Factor Superfamily Member 12; DR3LG; TNF-Related WEAK Inducer Of Apoptosis; APO3L; Tumor Necrosis Factor Ligand 4A; Tumor Necrosis Factor Ligand Superfamily Member 12; HCG1991317, Is
-
AA Sequence
RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 20-22 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wiley SR, et al. TWEAK, a member of the TNF superfamily, is a multifunctional cytokine that binds the TweakR/Fn14 receptor. Cytokine Growth Factor Rev. 2003 Jun-Aug;14(3-4):241-9. [Content Brief]
[2]. Maecker H, et al. TWEAK attenuates the transition from innate to adaptive immunity. Cell. 2005 Dec 2;123(5):931-44. [Content Brief]
[3]. Lammens A, et al. Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding. PLoS One. 2013 May 8;8(5):e62697. [Content Brief]
[4]. TNFSF12 TNF superfamily member 12 [Homo sapiens (human)]
[5]. Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274(13):8455-9. [Content Brief]
[6]. Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274(13):8455-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)