1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TWEAK/TNFSF12 Protein, Human (CHO)

TWEAK/TNFSF12 Protein, Human (CHO)

Cat. No.: HY-P7309
Handling Instructions

TWEAK/TNFSF12 Protein, Human (CHO) could induce apoptosis via multiple pathways of cell death in a cell type-specific manner and promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

TWEAK/TNFSF12 Protein, Human (CHO) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

CHO

Tag

Tag Free

Accession

O43508 (R99-H249)

Gene ID

8742

Synonyms
rHuTWEAK; TNF-related weak inducer of apoptosis; TNFSF12; DR3LG; APO3L
AA Sequence

RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Molecular Weight

20-22 kDa

Biological Activity
The ED50 is <1 ng/mL as measured by HTB-38 (HT-29) cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

TWEAK/TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. TWEAK is a ligand for the FN14/TWEAKR receptor. TWEAK has overlapping signaling functions with TNF, but displays a much wider tissue distribution. Leukocytes are the main source of TWEAK including human resting and activated monocytes, dendritic cells and natural killer cells[1]. TWEAK can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TWEAK/TNFSF12 Protein, Human (CHO)
Cat. No.:
HY-P7309
Quantity:
MCE Japan Authorized Agent: