UB2D3 Protein, Human (sf9, His, StrepⅡ)
The UBE2D3 protein is a key player in ubiquitination. It accepts ubiquitin from the E1 complex and covalently attaches it to a variety of proteins, demonstrating multifunctionality. It catalyzes "Lys-11" and "Lys-48" linked polyubiquitination in vitro, regulating protein ubiquitination patterns. UB2D3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2D3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UBE2D3 protein is a key player in ubiquitination. It accepts ubiquitin from the E1 complex and covalently attaches it to a variety of proteins, demonstrating multifunctionality. It catalyzes "Lys-11" and "Lys-48" linked polyubiquitination in vitro, regulating protein ubiquitination patterns. UB2D3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2D3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
UBE2D3, a pivotal participant in the ubiquitination process, accepts ubiquitin from the E1 complex and orchestrates its covalent attachment to diverse proteins, showcasing its versatility . In vitro, UBE2D3 catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, underscoring its role in regulating protein ubiquitination patterns. Collaborating with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex, UBE2D3 contributes to the polyubiquitination of NFKBIA, leading to subsequent proteasomal degradation. Functioning as an initiator E2, UBE2D3 primes the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin, a crucial step preceding ubiquitin chain elongation by CDC34. Notably, UBE2D3 serves as an initiator E2, in conjunction with RNF8, for the priming of PCNA, pivotal in the DNA damage tolerance pathway activated after DNA damage caused by UV or chemical agents during S-phase. Furthermore, UBE2D3 engages with various E3 ligases, including BRCA1/BARD1, MDM2, TOPORS, CBL, STUB1, RNF135, and ZNF598, showcasing its involvement in diverse ubiquitination processes, ranging from DNA repair to the regulation of viral RNA-dependent signaling pathways.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
P61077 (A2-M147)
-
Gene ID/
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UB2D3 (A2-M147)
Accession # P61077 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2D3; Ubiquitin Conjugating Enzyme E2 D3; UbcH5C; Ubiquitin‑Conjugating Enzyme E2D 3 (Homologous To Yeast UBC4/5); Ubiquitin‑Conjugating Enzyme E2D 3 (UBC4/5 Homolog,Yeast); (E3‑Independent) E2 Ubiquitin‑Conjugating Enzyme D3; Ubiquitin‑Conjugating Enzy
-
AA Sequence
ALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
