1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UB2D3 Protein, Human (sf9, His, StrepⅡ)

The UBE2D3 protein is a key player in ubiquitination. It accepts ubiquitin from the E1 complex and covalently attaches it to a variety of proteins, demonstrating multifunctionality. It catalyzes "Lys-11" and "Lys-48" linked polyubiquitination in vitro, regulating protein ubiquitination patterns. UB2D3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2D3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2D3 protein is a key player in ubiquitination. It accepts ubiquitin from the E1 complex and covalently attaches it to a variety of proteins, demonstrating multifunctionality. It catalyzes "Lys-11" and "Lys-48" linked polyubiquitination in vitro, regulating protein ubiquitination patterns. UB2D3 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2D3 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UBE2D3, a pivotal participant in the ubiquitination process, accepts ubiquitin from the E1 complex and orchestrates its covalent attachment to diverse proteins, showcasing its versatility . In vitro, UBE2D3 catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, underscoring its role in regulating protein ubiquitination patterns. Collaborating with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex, UBE2D3 contributes to the polyubiquitination of NFKBIA, leading to subsequent proteasomal degradation. Functioning as an initiator E2, UBE2D3 primes the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin, a crucial step preceding ubiquitin chain elongation by CDC34. Notably, UBE2D3 serves as an initiator E2, in conjunction with RNF8, for the priming of PCNA, pivotal in the DNA damage tolerance pathway activated after DNA damage caused by UV or chemical agents during S-phase. Furthermore, UBE2D3 engages with various E3 ligases, including BRCA1/BARD1, MDM2, TOPORS, CBL, STUB1, RNF135, and ZNF598, showcasing its involvement in diverse ubiquitination processes, ranging from DNA repair to the regulation of viral RNA-dependent signaling pathways.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

P61077 (A2-M147)

Gene ID

/

Molecular Construction
N-term
8*His-StrepⅡ
UB2D3 (A2-M147)
Accession # P61077
C-term
Protein Length

Partial

Synonyms
UBE2D3; Ubiquitin-conjugating enzyme E2 D3; (E3-independent) E2 ubiquitin-conjugating enzyme D3; E2 ubiquitin-conjugating enzyme D3; Ubiquitin carrier protein D3; Ubiquitin-conjugating enzyme E2(17)KB 3; Ubiquitin-conjugating enzyme E2-17 kDa 3; Ubiquitin-protein ligase D3
AA Sequence

ALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UB2D3 Protein, Human (sf9, His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UB2D3 Protein, Human (sf9, His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UB2D3 Protein, Human (sf9, His, StrepⅡ)
Cat. No.:
HY-P702065
Quantity:
MCE Japan Authorized Agent: