UB2E3 Protein, Human (sf9)

UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.

UB2E3, a pivotal component of the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, playing a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 demonstrates a versatile catalytic repertoire, facilitating 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, reflecting its involvement in diverse cellular processes. Notably, UB2E3 is implicated in the regulation of transepithelial sodium transport in renal cells, suggesting its significance in ion homeostasis. Additionally, its potential role in cell growth arrest underscores the multifaceted contributions of UB2E3 to cellular regulatory mechanisms, emphasizing its importance in maintaining cellular homeostasis and function.

Human

Sf9 insect cells

Tag Free

Q969T4 (S2-T207)

10477

Full Length of Mature Protein

SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.