1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UB2E3 Protein, Human (sf9)

UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.

Background

UB2E3, a pivotal component of the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, playing a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 demonstrates a versatile catalytic repertoire, facilitating 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, reflecting its involvement in diverse cellular processes. Notably, UB2E3 is implicated in the regulation of transepithelial sodium transport in renal cells, suggesting its significance in ion homeostasis. Additionally, its potential role in cell growth arrest underscores the multifaceted contributions of UB2E3 to cellular regulatory mechanisms, emphasizing its importance in maintaining cellular homeostasis and function.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q969T4 (S2-T207)

Gene ID

10477

Molecular Construction
N-term
UB2E3 (S2-T207)
Accession # Q969T4
C-term
Protein Length

Full Length of Mature Protein

Synonyms
UBE2E3; Ubiquitin-conjugating enzyme E2 E3; E2 ubiquitin-conjugating enzyme E3; UbcH9; Ubiquitin carrier protein E3; Ubiquitin-conjugating enzyme E2-23 kDa; Ubiquitin-protein ligase E3
AA Sequence

SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UB2E3 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UB2E3 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UB2E3 Protein, Human (sf9)
Cat. No.:
HY-P701487
Quantity:
MCE Japan Authorized Agent: