UB2E3 Protein, Human (sf9)
UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.
Background
UB2E3, a pivotal component of the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, playing a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 demonstrates a versatile catalytic repertoire, facilitating 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, reflecting its involvement in diverse cellular processes. Notably, UB2E3 is implicated in the regulation of transepithelial sodium transport in renal cells, suggesting its significance in ion homeostasis. Additionally, its potential role in cell growth arrest underscores the multifaceted contributions of UB2E3 to cellular regulatory mechanisms, emphasizing its importance in maintaining cellular homeostasis and function.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q969T4 (S2-T207)
-
Gene ID10477
-
Molecular Construction
-
N-term
-
UB2E3 (S2-T207)
Accession # Q969T4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2E3; Ubiquitin Conjugating Enzyme E2 E3; UbcH9; Ubiquitin-Conjugating Enzyme E2E 3 (Homologous To Yeast UBC4/5); Ubiquitin-Conjugating Enzyme E2E 3 (UBC4/5 Homolog,Yeast); Ubiquitin-Conjugating Enzyme E2-23 KDa; Ubiquitin-Conjugating Enzyme E2 E3; E2 U
-
AA Sequence
SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)