UB2E3 Protein, Human (sf9)

UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UB2E3 protein is a key ubiquitin-proteasome system component. As an E2 ubiquitin-conjugating enzyme, it plays a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 exhibits diverse catalytic abilities, promoting polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E3 Protein, Human (sf9) is the recombinant human-derived UB2E3 protein, expressed by sf9 insect cells , with tag free.

Background

UB2E3, a pivotal component of the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, playing a crucial role in the attachment of ubiquitin to target proteins. In vitro, UB2E3 demonstrates a versatile catalytic repertoire, facilitating 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, reflecting its involvement in diverse cellular processes. Notably, UB2E3 is implicated in the regulation of transepithelial sodium transport in renal cells, suggesting its significance in ion homeostasis. Additionally, its potential role in cell growth arrest underscores the multifaceted contributions of UB2E3 to cellular regulatory mechanisms, emphasizing its importance in maintaining cellular homeostasis and function.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • UB2E3 (S2-T207)
      Accession # Q969T4
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2E3; Ubiquitin Conjugating Enzyme E2 E3; UbcH9; Ubiquitin-Conjugating Enzyme E2E 3 (Homologous To Yeast UBC4/5); Ubiquitin-Conjugating Enzyme E2E 3 (UBC4/5 Homolog,Yeast); Ubiquitin-Conjugating Enzyme E2-23 KDa; Ubiquitin-Conjugating Enzyme E2 E3; E2 U

  • AA Sequence

    SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00