UB2V1 Protein, Human (sf9, His, StrepⅡ)
The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UB2V1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2V1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UB2V1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2V1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
The UBE2V1 protein, on its own, lacks ubiquitin ligase activity. However, when forming a heterodimer with UBE2N, it catalyzes the synthesis of non-canonical poly-ubiquitin chains linked through Lys-63. This type of poly-ubiquitination activates IKK and does not involve protein degradation by the proteasome. UBE2V1 plays a crucial role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6, and TRAF2, contributing to the transcriptional activation of target genes. Additionally, it participates in cell cycle progression, differentiation, and the error-free DNA repair pathway, enhancing cell survival after DNA damage. Furthermore, UBE2V1 promotes TRIM5 capsid-specific restriction activity, collaborating with UBE2N to generate 'Lys-63'-linked polyubiquitin chains that activate the MAP3K7/TAK1 complex, leading to the induction of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, UBE2V1 catalyzes viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIGI, activating the downstream signaling pathway for interferon beta production. In association with TRAF3IP2 E3 ubiquitin ligase, UBE2V1-UBE2N mediates 'Lys-63'-linked polyubiquitination of TRAF6 in the IL17A-mediated signaling pathway. It forms a heterodimer with UBE2N and interacts with various proteins, including STUB1 and TRAF6, contributing to diverse cellular processes and signaling pathways.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q13404 (A2-N147)
-
Gene ID387522
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UB2V1 (A2-N147)
Accession # Q13404 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2V1; Ubiquitin Conjugating Enzyme E2 V1; UBE2V; CROC-1; UEV-1; CROC1; Ubiquitin-Conjugating Enzyme E2 Variant 1; UEV1A; TRAF6-Regulated IKK Activator 1 Beta Uev1A; UEV1; HCG2018358,Isoform CRA_d; DNA-Binding Protein; CIR1
-
AA Sequence
AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)