1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. UCHL5 Protein, Human

UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.

Background

UCHL5, a protease of notable specificity, is tasked with the cleavage of 'Lys-48'-linked polyubiquitin chains, operating as a deubiquitinating enzyme intricately associated with the 19S regulatory subunit of the 26S proteasome. While positioned as a putative regulatory component within the INO80 complex, UCHL5 remains inactive within this context. However, a transient interaction between the INO80 complex and the proteasome, facilitated by ADRM1, serves as the key activator for UCHL5, unlocking its deubiquitinating prowess. This nuanced regulatory role highlights UCHL5's participation in the dynamic interplay between ubiquitin-dependent processes and the proteasomal machinery.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9Y5K5 (T2-K329)

Gene ID

51377

Molecular Construction
N-term
UCHL5 (T2-K329)
Accession # Q9Y5K5
C-term
Protein Length

Partial

Synonyms
UCHL5; Ubiquitin carboxyl-terminal hydrolase isozyme L5; UCH-L5; Ubiquitin C-terminal hydrolase UCH37; Ubiquitin thioesterase L5
AA Sequence

TGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

Predicted Molecular Mass
37.6 KDa
Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UCHL5 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UCHL5 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCHL5 Protein, Human
Cat. No.:
HY-P701406
Quantity:
MCE Japan Authorized Agent: