UCHL5 Protein, Human
Based on 1 Customer Validation
UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.
UCHL5, a protease of notable specificity, is tasked with the cleavage of 'Lys-48'-linked polyubiquitin chains, operating as a deubiquitinating enzyme intricately associated with the 19S regulatory subunit of the 26S proteasome. While positioned as a putative regulatory component within the INO80 complex, UCHL5 remains inactive within this context. However, a transient interaction between the INO80 complex and the proteasome, facilitated by ADRM1, serves as the key activator for UCHL5, unlocking its deubiquitinating prowess. This nuanced regulatory role highlights UCHL5's participation in the dynamic interplay between ubiquitin-dependent processes and the proteasomal machinery.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y5K5 (T2-K329)
-
Gene ID51377
-
Molecular Construction
-
N-term
-
UCHL5 (T2-K329)
Accession # Q9Y5K5 -
C-term
-
-
Protein Length
Partial
-
Synonyms
UCHL5; Ubiquitin C‑Terminal Hydrolase L5; UCH37; CGI‑70; INO80R; Ubiquitin Carboxyl‑Terminal Hydrolase Isozyme L5; Ubiquitin Carboxyl‑Terminal Hydrolase L5; Ubiquitin C‑Terminal Hydrolase UCH37; Ubiquitin Thioesterase L5; INO80 Complex Subunit R; UCH‑L5;
-
AA Sequence
TGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
-
Predicted Molecular Mass
37.6 KDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
