UCHL5 Protein, Human

Customer Review

Based on 1 Customer Validation

UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UCHL5 is a highly specific protease that acts as a deubiquitinating enzyme intricately linked to the 19S proteasome subunit, cleaving "Lys-48" linked polyubiquitin chains. Although the INO80 complex is inert, transient interactions between INO80 and the proteasome (facilitated by ADRM1) activate UCHL5. UCHL5 Protein, Human is the recombinant human-derived UCHL5 protein, expressed by E. coli , with tag free.

Background

UCHL5, a protease of notable specificity, is tasked with the cleavage of 'Lys-48'-linked polyubiquitin chains, operating as a deubiquitinating enzyme intricately associated with the 19S regulatory subunit of the 26S proteasome. While positioned as a putative regulatory component within the INO80 complex, UCHL5 remains inactive within this context. However, a transient interaction between the INO80 complex and the proteasome, facilitated by ADRM1, serves as the key activator for UCHL5, unlocking its deubiquitinating prowess. This nuanced regulatory role highlights UCHL5's participation in the dynamic interplay between ubiquitin-dependent processes and the proteasomal machinery.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • UCHL5 (T2-K329)
      Accession # Q9Y5K5
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UCHL5; Ubiquitin C-Terminal Hydrolase L5; UCH37; CGI-70; INO80R; Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L5; Ubiquitin Carboxyl-Terminal Hydrolase L5; Ubiquitin C-Terminal Hydrolase UCH37; Ubiquitin Thioesterase L5; INO80 Complex Subunit R; UCH-L5;

  • AA Sequence

    TGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

  • Predicted Molecular Mass

    37.6 KDa

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00