UfSP1 Protein, Human
UfSP1 Protein, Human is the recombinant human-derived UfSP1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
UfSP1 Protein, Human is the recombinant human-derived UfSP1, expressed by E. coli , with tag Free labeled tag. ,
UfSP1 is a thiol-dependent isopeptidase that specifically mediates the processing of UFM1 precursors and the deconjugation of UFM1 from target proteins. It is primarily responsible for the maturation of the UFM1 precursor, which is a prerequisite for subsequent conjugation reactions. by similar: These functions have been validated in related studies.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q6NVU6 (M1-D142)
-
Gene ID402682
-
Protein Length
Partial
-
Synonyms
UFSP1; UFM1 Specific Peptidase 1; UFSP; UFM1 Specific Peptidase 1 (Inactive); Ufm1‑Specific Protease 1; UFM1‑Specific Peptidase 1 (Non‑Functional); Inactive Ufm1‑Specific Protease 1; UfSP1
-
AA Sequence
MEPLRDVHVGLSPPSRGPVRLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPEGQPAGVPGLAAVQAALEDMGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGD
-
Predicted Molecular Mass
15.1 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
