UfSP1 Protein, Human
UfSP1 Protein, Human is the recombinant human-derived UfSP1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UfSP1 Protein, Human is the recombinant human-derived UfSP1, expressed by E. coli , with tag Free labeled tag. ,
Background
UfSP1 is a thiol-dependent isopeptidase that specifically mediates the processing of UFM1 precursors and the deconjugation of UFM1 from target proteins. It is primarily responsible for the maturation of the UFM1 precursor, which is a prerequisite for subsequent conjugation reactions. by similar: These functions have been validated in related studies.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q6NVU6 (M1-D142)
-
Gene ID402682
-
Protein Length
Partial
-
Synonyms
UFSP1; UFM1 Specific Peptidase 1; UFSP; UFM1 Specific Peptidase 1 (Inactive); Ufm1-Specific Protease 1; UFM1-Specific Peptidase 1 (Non-Functional); Inactive Ufm1-Specific Protease 1; UfSP1
-
AA Sequence
MEPLRDVHVGLSPPSRGPVRLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPEGQPAGVPGLAAVQAALEDMGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGD
-
Predicted Molecular Mass
15.1 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
