UHMK1 Protein, Human (sf9, GST)
UHMK1 Protein, Human (sf9, GST) is the recombinant human-derived UHMK1, expressed by Sf9 insect cells , with GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UHMK1 Protein, Human (sf9, GST) is the recombinant human-derived UHMK1, expressed by Sf9 insect cells , with GST labeled tag. ,
Background
UHMK1 is a kinase that phosphorylates CDKN1B/p27Kip1 upon serum stimulation, thereby regulating the subcellular localization of CDKN1B and cell cycle progression in the G1 phase. By similarity, it may also be involved in RNA trafficking and/or processing.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q8TAS1-1 (M1-L419)
-
Gene ID127933
-
Protein Length
Full Length of Isoform-1
-
Synonyms
UHMK1; U2AF Homology Motif Kinase 1; KIS; Kist; PAM COOH-Terminal Interactor Protein 2; Serine/Threonine-Protein Kinase Kist; U2AF Homology Motif (UHM) Kinase 1; P-CIP2; Kinase Interacting With Leukemia-Associated Gene (Stathmin); Kinase Interacting With
-
AA Sequence
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
