ulp1 Protein, Schizosaccharomyces pombe (His)
ulp1 Protein, Schizosaccharomyces pombe (His) is the recombinant ulp1, expressed by E. coli , with His labeled tag. ,
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ulp1 Protein, Schizosaccharomyces pombe (His) is the recombinant ulp1, expressed by E. coli , with His labeled tag. ,
Background
ulp1 is a cysteine protease that proteolytically removes the C-terminus of pmt3.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag His
-
Accession
O42957 (E344-Y568)
-
Gene ID2540734
-
Protein Length
Partial
-
Synonyms
ulp1; SPBC19G7.09; Ubiquitin-like-specific protease 1; EC 3.4.22.-
-
AA Sequence
ELEFPDNARKRALKYLNQSNSVSSSEPIITKFNIPITLKDLHTLRNRQWLNDEVINFYMNLISERSKIDSSLPRVHGFNTFFYTSLQRRGYAGVRRWAKKARVNIADMDAVFIPVHLDVHWCMAVINKSKKRFEYWDSLAGSPGKVFDLLRDYYIAETKGAVDVSDWENFMDDNSPRQRNGHDCGVFACKTAECVSRNVPVQFSQNDMPELRIKMAASIIDAQIY
-
Predicted Molecular Mass
29.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
